KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1522Help
Entry
Y1U_C1522         CDS       T02116                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00970  Aminoacyl-tRNA biosynthesis
stw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Y1U_C1522
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:stw03029]
    Y1U_C1522
Enzymes [BR:stw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Y1U_C1522
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Y1U_C1522
Mitochondrial biogenesis [BR:stw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Y1U_C1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFJ83971
LinkDB All DBs
Position
complement(1483151..1484617)
Genome map
AA seq 488 aa AA seqDB search
MSFNNKTIEELHNLLVSKEISATELTQATIDDIKAREEAVNAFVTVAEEAALAQAKAIDE
KGIDADNLLSGIPFAVKDNISTDGILTTAASKMLYNYEPIFDATAVANAKAKDMIVIGKT
NMDEFAMGGSGETSYYGSTKNAWDHSKVPGGSSSGSAAAVASGQVRLSLGSDTGGSIRQP
AAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGTFSQTVKENAQLLNVIASEDAKDSTSAP
VRIADFTSKIGQDIKSMKIALPKEYLGEGIDPEVKETILDAAKHFEKLGATVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGFRAEDAKNLDDIYVNTRSQGFGDEVKRRIMLG
TFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILGPTAPSVAFDLDTLNHDPVAMY
LADLLTIPVNLAGLPGISIPAGFAQGLPVGLQLIGPKYSEETIYQAAAAFEATTDYHKQQ
PVIFGGDN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcaacaataaaaccattgaagagttgcacaatctccttgtctctaaggaaatt
tcagcaaccgaattgacacaagcgaccattgacgatatcaaggcgcgtgaagaagcagtc
aatgcctttgtgacagtagcagaagaagctgcccttgcacaagctaaggccattgacgaa
aaaggaatcgatgctgacaacctcctgtcagggattccattcgctgtcaaagacaatatc
tctactgacggcattttgacgactgcggcctcaaaaatgctctataactacgagcctatt
tttgatgcgacagcggttgctaatgccaaagctaaagatatgattgtcatcgggaaaact
aacatggatgaatttgctatgggtggatctggtgagacttcttactatggatcaaccaag
aatgcttgggatcacagcaaggttcctggtgggtcatctagtggttcggcagcagctgta
gcttcaggtcaagtccgtttgtctcttggttcagatacaggtggctctatccgccaaccg
gctgcctttaacgggattgttggccttaagccaacttacggaacggtttctcgtttcggt
ctcattgcttttggtagctcacttgaccagattggtacgttctcacaaactgttaaggaa
aatgcccaattgctcaatgttattgccagtgaagatgctaaggattcaacatctgcgcca
gtccgcatagccgattttacttctaagattggtcaagacatcaaaagtatgaagattgct
cttcctaaggaataccttggggaagggattgacccagaagttaaagaaaccatcctcgat
gcggctaagcactttgaaaaattgggagcaacagtcgaggaagtcagcctgcctcattct
aaatacggggttgctgtctactacatcattgcttcatctgaagcctcttcaaacttgcaa
cgtttcgatggcattcgctatggtttccgtgcggaagatgccaagaacttggatgacatc
tacgtaaacactcgtagccaaggctttggtgatgaagtcaaacgtcgtatcatgctgggt
acctttagtttgtcatctggttactacgatgcttactacaagaaagctggtcaagttcgt
accctcattatccaagacttcgaaaaagtctttgcggattacgatctcatccttggtcct
acagctccaagcgtagctttcgatttggatacgctcaatcatgatcctgttgccatgtac
ttggcggacttgttgaccattccagttaacttggcaggtcttccagggatttcgattcct
gcaggttttgcgcaaggtcttccagttggtttgcagttgattggtcctaagtattctgaa
gagaccatctatcaagctgcagctgcttttgaagctacaacggattaccataagcaacaa
cccgtgatttttggaggtgacaattaa

DBGET integrated database retrieval system