KEGG   Streptococcus pyogenes MGAS1882 (serotype M59): MGAS1882_1044Help
Entry
MGAS1882_1044     CDS       T02062                                 

Gene name
inlA
Definition
(GenBank) putative internalin protein InlA
Organism
stx  Streptococcus pyogenes MGAS1882 (serotype M59)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 Strep_his_triad LRR_8 LRR_9 HTH_3 Tir_receptor_M SelP_N
Motif
Other DBs
NCBI-ProteinID: AFC68252
LinkDB All DBs
Position
complement(1036898..1039276)
Genome map
AA seq 792 aa AA seqDB search
MKTKKVIILVGLLLSSQLTLIACQSRGNGTYPIKTKQSRKGMTSNKIKPIKKSKKTNKTH
KGVAGIDFPTDDGFILTKDSKILSKTDQGIVVDHDGHSHFIFYADLKGSPFEYLIPKGAS
LAKPAVAQQAASQGTSKVADPHHHYEFNPADIVAEDALGYTVRHDDHFHYILKSSLSGQT
QAQAKQVATRLPQTSSPVSTATANGIPGLHFPTSDGFQFNGQGIVGVTKDSILVDHDGHL
HPISFADLRQGGWAHVADQYDPAKKADKLTEPNQTQEQANREKEYQEKLAYLAEKLGIDP
STIKRVETQDGKLGLEYPHHDHAHVLMLSDIEIGKDIPDPHAIEHARELEKHKVGMDTLR
ALGFDEEVILDIVRTHDAPTPFPSNEKDPNKMKEWLATVIKLDLGSRKDPLQRKGLSLLP
NLETLGIGFTPIKDISPVLQFKKLKRLLMTKTGVTDYRFLDNMPQLEGIDISQNNLKDIS
FLSKYKNLTLVAAADNGIEDIRPLGQLPNLKFLVLSNNKISDLSPLASLHQLQELHIDNN
PITDLSPVSHKESLTVVDLSRNADVDLATLQAPKLETLMVNDTKVSHLDFLKNNPNLSSL
SINRAQLQSLEGIEASSVIVRVEAEGNQIKSLVLKDKQGSLTFLDVTGNQLTSLEGVNNF
TALDILSVSKNQLTNVNLSKPNKTVTNIDISHNNIPLADLKLNEQHIPEAIAKNFPAVYE
GSMVGNGTAEEKAAMATKAKESAQEASESHDYNHNHTYEDEEGHAHEHRDKDDHDHEHED
ENEAKDEQNHAD
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaaaaagttattattttagttggtctattgttatcatctcagttgactttg
atagcttgtcaatcacgaggtaatggtacatatcccattaaaacgaaacaatcacgtaag
ggaatgacgtcaaacaaaattaaaccgattaaaaaaagcaaaaagacaaacaagactcac
aaaggtgtggcgggtatcgattttcctacagatgatgggtttattttaaccaaagactca
aaaatcttatcaaaaacagatcagggaatcgttgttgaccatgatggtcattcgcatttt
attttttatgccgatttaaagggaagtccatttgaataccttattccaaaaggagcaagt
ttagctaagccagctgttgctcagcaagcagctagtcaagggacttctaaagtagcagat
cctcatcaccattatgaatttaacccagcggatattgtggctgaagatgctttaggctac
acggttcgccacgatgatcacttccattatattttgaagtcaagcttatcaggtcagaca
caggcacaagctaaacaggttgctactcgcttgccacaaaccagtagccctgtttcaaca
gctacagctaatggtattccaggcttgcatttcccaacctcagatggttttcaatttaac
ggtcaaggtattgttggggtaacaaaagacagtattttagtggaccacgatggtcacttg
caccctatttcttttgctgaccttcgtcaaggtggttgggcacatgttgcagatcaatac
gatcctgctaaaaaagcagataaactaacagaacctaatcagacacaagaacaagcaaat
cgtgaaaaagaatatcaagaaaaattagcttatctggcagaaaaattgggcattgatcca
tcaactattaaacgtgtggaaacacaagacggtaaacttggtttggaataccctcaccat
gaccacgcacacgtattgatgttatctgatattgaaatcggaaaagacattccagatcca
catgctattgagcatgcccgtgaattggaaaaacataaggttggaatggataccttgcgt
gccttagggtttgatgaagaagtgattttggatatcgttcgcactcacgatgctccaacc
ccattcccatcaaatgaaaaagatccgaataagatgaaagaatggttagcaacggttatt
aaacttgacttgggcagccgtaaagatcctttgcaacgtaaaggactttcactgttaccc
aacttagaaactttaggaattggctttacaccaatcaaagatatctcacctgttttgcaa
tttaaaaaattgaaacggttgctaatgacaaaaacaggggtgactgattatagatttttg
gataatatgccacagttagaaggcattgatatttcacaaaacaatctcaaagatattagt
ttcttgagcaaatataaaaacttaactctagtagcggctgctgataatggtattgaagat
attaggccgcttggtcaattaccaaatctcaaattcctcgtattgagtaataataagatt
tctgatttaagcccactggcatcgttacatcaattgcaagaattgcacattgataataat
ccgattacagatttaagccctgtttctcataaagaatcattgacggttgttgatttatca
agaaatgctgatgttgacttagcaacacttcaagcacccaaattagaaacgttaatggtc
aatgataccaaggtttctcatttggatttcttgaaaaataatcctaatctatctagccta
tctattaaccgtgcgcaattgcaatctcttgaaggtattgaagcaagtagcgtcattgtc
agagtagaagcagaaggcaaccaaattaaatcgcttgtgcttaaagacaagcaagggtca
cttactttcttggatgtgacaggcaaccagttgacttctctagaaggtgttaataatttt
acagcacttgacattttaagcgtgtctaaaaaccaattaacaaatgtcaacctatctaaa
cccaataagacagttactaacattgatattagtcataacaatatcccattggcagacctt
aaattgaacgagcaacatattccagaagccattgcgaaaaacttcccagcggtttacgaa
ggttctatggtaggtaatggaacagctgaagaaaaagcagctatggctactaaggcgaaa
gaaagtgctcaagaagcatcggaatcacatgactacaaccataatcatacctatgaagat
gaagaaggtcatgctcacgagcacagagacaaagatgatcacgaccatgaacatgaggat
gaaaatgaagctaaagatgagcaaaaccatgctgactaa

DBGET integrated database retrieval system