KEGG   Streptococcus pyogenes MGAS1882 (serotype M59): MGAS1882_1393Help
Entry
MGAS1882_1393     CDS       T02062                                 

Gene name
accC
Definition
(GenBank) biotin carboxylase of acetyl-CoA carboxylase protein AccC
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
stx  Streptococcus pyogenes MGAS1882 (serotype M59)
Pathway
stx00061  Fatty acid biosynthesis
stx00620  Pyruvate metabolism
stx00640  Propanoate metabolism
stx01100  Metabolic pathways
stx01110  Biosynthesis of secondary metabolites
stx01120  Microbial metabolism in diverse environments
stx01130  Biosynthesis of antibiotics
stx01200  Carbon metabolism
stx01212  Fatty acid metabolism
Module
stx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:stx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS1882_1393 (accC)
   00640 Propanoate metabolism
    MGAS1882_1393 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MGAS1882_1393 (accC)
Enzymes [BR:stx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MGAS1882_1393 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MGAS1882_1393 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 DUF3182 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFC68585
LinkDB All DBs
Position
complement(1366972..1368336)
Genome map
AA seq 454 aa AA seqDB search
MFKKILIANRGEIAVRIIRAARELGISTVAVYSEADKEALHTILADEAICIGPARSKESY
LNMNSVLSAAIVTGAQAIHPGFGFLSENSKFATMCEEMNIKFIGPSASVMDKMGDKINAR
SEMIKAGVPVIPGSDGEVYNAQEALAIANKIGYPVMLKASAGGGGKGIRKVETEADLEAA
FNAASQEALGAFGNGAMYLEKVIYPARHIEVQILGDAHGNIIHLGERDCSLQRNNQKVLE
ESPSIAIGNTLRHEMGQAAVRAAKAVAYENAGTIEFLLDEDSEKFYFMEMNTRIQVEHPV
TEFVTGVDIVKEQIKIAAGQPLAINQEDITITGHAIECRINAENTAFNFAPSPGKITDLY
MPSGGVGLRVDSAVYNGYAIPPYYDSMIAKIIVHGSNRFDALMKMQRALVELEIEGIITN
TDFQLDLISDKRVIAGDYDTSFLMETFLPHYNKD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaatcttaattgctaatcgtggtgaaattgcagtgcgtatcattcgtgct
gcacgagaattagggatttccacagttgcagtttattcggaagcggataaggaagctctg
cacacgatattggcggacgaggctatctgtattggccctgcccgttccaaggaatcctat
cttaatatgaattccgtcttgtcagcagctattgtgacaggagcccaagcgattcatcca
gggtttggctttttaagtgaaaactcaaagtttgcgaccatgtgtgaagagatgaatatt
aaatttatcggtccatccgcatcggttatggataaaatgggtgataaaatcaatgctcgt
tctgaaatgattaaggcaggagtgcccgttattccagggtcagatggtgaagtttataac
gctcaagaagccttagctattgccaataagattggttatcctgtcatgctaaaagcatca
gcaggtggcggtggtaaagggattcgtaaagtggagacagaagcagatttggaggcggct
ttcaatgctgctagtcaagaagctttgggagctttcggaaatggcgccatgtatttggaa
aaagtaatttacccagctagacatattgaggtgcaaattttaggagacgctcacggtaac
atcattcacttgggagaacgggattgctccttgcaacggaataatcaaaaagtcttggaa
gaaagtccatccattgctattggtaataccctcagacacgaaatggggcaagcagcggtt
agagcagctaaagctgtagcctatgaaaatgcgggaaccattgagtttttgttggacgaa
gacagcgagaaattctatttcatggaaatgaatacccgtatccaagttgagcatcctgtc
accgaatttgtgacaggagtggatattgtcaaagagcaaatcaaaattgcagcaggtcag
cctttggcgattaatcaagaagacatcactatcacgggacatgctattgaatgtcgtatc
aatgctgaaaatactgcttttaactttgcaccgagtcccggaaagattacagacttgtat
atgccaagtggtggtgtaggactacgagttgattcagcagtttacaatggctatgccatt
cctccttattatgacagcatgattgctaaaatcatcgttcatggaagcaatagatttgac
gctttgatgaaaatgcaacgtgccttagttgaattggaaattgaaggcattatcaccaat
acagacttccagctcgatttgatttcagataagcgagtgattgcaggagattatgatacc
tctttcttgatggaaacgttcctgccacattacaataaagattag

DBGET integrated database retrieval system