KEGG   Streptococcus pyogenes MGAS1882 (serotype M59): MGAS1882_1420Help
Entry
MGAS1882_1420     CDS       T02062                                 

Definition
(GenBank) protein/aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stx  Streptococcus pyogenes MGAS1882 (serotype M59)
Pathway
stx00220  Arginine biosynthesis
stx00250  Alanine, aspartate and glutamate metabolism
stx00290  Valine, leucine and isoleucine biosynthesis
stx01100  Metabolic pathways
stx01110  Biosynthesis of secondary metabolites
stx01130  Biosynthesis of antibiotics
stx01210  2-Oxocarboxylic acid metabolism
stx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGAS1882_1420
   00290 Valine, leucine and isoleucine biosynthesis
    MGAS1882_1420
   00220 Arginine biosynthesis
    MGAS1882_1420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stx01007]
    MGAS1882_1420
Enzymes [BR:stx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MGAS1882_1420
    2.6.1.66  valine---pyruvate transaminase
     MGAS1882_1420
Amino acid related enzymes [BR:stx01007]
 Aminotransferase (transaminase)
  Class I
   MGAS1882_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFC68612
LinkDB All DBs
Position
complement(1390294..1391508)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELISMSLQALLDNGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGHQSVDALL
LPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgttgcctatgatattcgagggcct
gttttggatgaagctaatcgcatgattgcgagtggtgaaaaaattctgcgtttaaatact
ggcaatcctgctgcctttggttttgaagcaccagatgaagtgattcgtgatttaattgtc
aacgcgaggctaagtgagggctattctgacagtaaagggattttttcagcgcgtaaggct
atcatgcaatattgccaactcaagggcttcccagatgttgacattgaagatatttatttg
ggaaatggcgtgtcagagttgatatccatgtcccttcaagctttgctagataatggcgat
gaagttttagtaccaatgccggattatcctttatggacggcttgtgtgagtcttggtgga
ggaaaagcggtccattatctttgtgatgaagaagctggttggtatcctgatattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaatcctaataaccca
acaggagccctttatcctaaggagattttagaagacatcgttgctttggcaagagaacac
cagctgattatttttgccgatgaaatctatgatcgtttggtgatggatggtaaagagcat
attgctattgcaagtttggcacctgatgttttttgtgtatctatgaatggcctttccaaa
tctcatcgtattgctggttttcgtgttggatggatggtcttatcaggtcctaaagaccat
gttaaaggttacattgaagggttaaacatgcttgccaatatgcggttatgctccaatgtt
ttagcccaacaagttgttcaaacttccttaggaggccatcaatcagttgatgcactgtta
ctgccaggagggcgtatttttgagcaacgtaattttatttatgaagctattaatgctatc
cctggcttatcggcagttaaacctgaagcaggtctttatttatttccgaaaattgatcgt
cagatgtatcgtattgatgatgacgaagaatttgtcttacagttattaaagcaagaaaaa
gtgatgttggtacatggacgtggttttaactggaaagatccagatcacttccgtattgtt
tacctaccaagtgtagaagaattagaagatgtccaagaaaagattacacgtgtcttatac
cagtatagacgttaa

DBGET integrated database retrieval system