KEGG   Streptococcus pyogenes MGAS1882 (serotype M59): MGAS1882_1674Help
Entry
MGAS1882_1674     CDS       T02062                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase protein (F) AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stx  Streptococcus pyogenes MGAS1882 (serotype M59)
Brite
KEGG Orthology (KO) [BR:stx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MGAS1882_1674 (ahpF)
Enzymes [BR:stx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MGAS1882_1674 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 FAD_oxidored GIDA HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 Glutaredoxin Lycopene_cycl Thioredoxin_4 NAD_binding_8 LPD7 NAD_binding_9 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AFC68852
LinkDB All DBs
Position
1659423..1660955
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDR
QPSFKVAKKGHDSGVVFAGLPLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNGKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQVAGPFSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETIGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLT
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTNNMTIIKNVATKDIVGEDHVTGLNY
TERDSGEDKHLDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccctgttagaagct
gatcttgttttgcaagtttcccttggtgacaatgagcagtctcaaaaagtcaaagacttt
gtggaagaaatagctgctatgtctgagcgtatttctattgaaaacatcactttagaccga
caaccaagctttaaggttgcgaaaaaaggtcacgatagtggggttgtctttgctggtctt
cctttaggccacgaattgacgtcctttattcttgctctcttgcaagtatctggacgtgct
ccaaaagtggatcaagatgttattgatcgcatcaaggccattgaccgtccgttgcatttt
gaaacttatgtcagcttaacctgccataactgcccagatgttgttcaagctttaaacatt
atgtccgtcttgaacggcaagatttcacacactatggtagaaggcggcatgttccaagat
gaagtgaaagcaaaaggcattatgtctgtaccaactgtcttcttagatggtgaagaattc
acttcaggtcgtgctaccattgagcaactcttagaacaagtcgctggcccattttctgag
gaagcctttgctgataaaggcctctatgatgtccttgttattggtggtggccctgcgggc
aatagcgctgctatctatgcagctcgtaaaggactaaaaacaggtttacttgctgaaacc
tttggtggtcaggtcatggaaactatcggcatcgaaaacatgattggtaccctttacact
gaaggaccaaaattaatggccgaagtggaggcccatactaagtcttatgatgttgatatt
atcaaagcacaactagctacttctattgagaaaaaagaaaacatcgaggttactctaact
aatggtgcggttctacaagccaaaactgctatcttagctcttggggccaaatggcgtaac
attaatgttcctggtgaagatgaattccgtaataaaggggtgacttactgccctcactgt
gacggtcctctctttgaaggcaaagatgttgctgttatcggtggtggtaactctggatta
gaagctgcccttgatttggctggtcttgctaaacacgtttacgttttagaattcttgcct
gaacttaaagctgacaaagtgcttcaagaccgcgcagctaagactaacaatatgaccatc
atcaaaaatgttgctactaaggatattgttggagaggaccatgttacaggtcttaactac
actgagcgtgatagcggtgaagacaaacaccttgaccttgaaggggtctttgtccaaatt
ggtcttgttccaaacacagcttggctcaaggatagcggtgtgaacctaaccgaccgcgga
gaaatcattgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttccatggggtctggtgctactgctgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system