KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2307
Entry
STY2307           CDS       T00064                                 

Gene name
rfbB
Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00521  Streptomycin biosynthesis
sty00523  Polyketide sugar unit biosynthesis
sty00525  Acarbose and validamycin biosynthesis
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
Module
sty_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    STY2307 (rfbB)
   01055 Biosynthesis of vancomycin group antibiotics
    STY2307 (rfbB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STY2307 (rfbB)
   00525 Acarbose and validamycin biosynthesis
    STY2307 (rfbB)
Enzymes [BR:sty01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     STY2307 (rfbB)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind adh_short KR Gp_dh_N Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 1248642
NCBI-ProteinID: NP_456646
GeneDB: STY2307
UniProt: Q8Z5H9
LinkDB
Structure
PDB: 
1KEW 1KEU 1G1A

Position
complement(2135484..2136569)
AA seq 361 aa
MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC
DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE
DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA
WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA
RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH
DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQWVNNVKSGAYQSWIEQNYEGR
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
gtgaagatacttattactggcggggcaggttttattggatcagctgttgttcgccatatt
attaagaatacacaggacactgtagttaatattgataaattaacctacgccggtaatctt
gaatccctttctgatatttctgaaagtaatcgctacaattttgaacacgcggatatttgt
gattccgctgaaataacgcgtatttttgagcagtaccagccggacgcggtgatgcatttg
gctgcggaaagtcatgtggaccgttcgattaccgggccggcagcatttattgaaaccaat
atcgtcggcacctatgtacttcttgaagttgcgcgtaaatactggtctgcgcttggcgaa
gataaaaaaaataattttcgttttcatcatatttccactgatgaagtttacggcgattta
ccacatcctgatgaagttgaaaacagcgttacgttgccgttatttactgaaacgacggca
tatgcgccaagtagcccctattctgcgtcaaaagcatccagcgatcatttagtccgtgcc
tggcggcgtacctatggtctaccaacgatcgttaccaattgttctaataactatggccct
tatcacttccctgaaaaactgattccgttggtcattttgaacgcactggaaggaaagcct
ttgccaatttatggcaaaggggatcagattcgcgattggctatatgtagaagatcacgct
cgcgcgcttcatatggtagtgactgaaggcaaggcaggggagacttataacattggtggc
cacaatgagaagaaaaatctcgatgtggtatttaccatctgtgatctgctggatgagatt
gtacccaaagcgacttcttatcgtgaacaaatcacttatgtcgcggatcgtccgggccat
gatcgtcgttatgccattgatgcaggtaaaattagccgtgaattaggctggaaaccgctg
gagacctttgaaagcggtattcgtaaaacagtggaatggtaccttgcaaatactcaatgg
gtaaacaatgttaaaagtggggcgtatcagagttggatagaacagaactatgaaggacgc
cagtaa

DBGET integrated database retrieval system