KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3444
Entry
STY3444           CDS       T00064                                 

Gene name
gatD
Definition
(RefSeq) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00052  Galactose metabolism
sty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    STY3444 (gatD)
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     STY3444 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 MTS ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 Methyltransf_11 3HCDH_N PrmA UDPG_MGDP_dh_N Shikimate_DH Met_10 Pyr_redox_2 Sacchrp_dh_NADP CoA_binding ELFV_dehydrog Pyr_redox Methyltransf_24 FAD_binding_2 Fer4_4
Other DBs
NCBI-GeneID: 1249701
NCBI-ProteinID: NP_457645
GeneDB: STY3444
LinkDB
Position
3287473..3288516
AA seq 347 aa
MKSVVIHAEGDVRVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQLVLETAGTP
QTVSLAIDITGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLTPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgcgcgttgaagaacgtcccttacca
caactgcaagccgaggacgatgtgttggtcaaagtcgttagctcagggctttgcgggtcg
gatatcccgcgtattttcgcgcagggcgcccattattatcctattacgttaggccatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcctggcgatgcc
gtcgcttgtgtcccgcttcttccctgctttcactgtccgcaatgcgaacgcggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgcagcgaaggcggtaatgcggaatat
gtggtggtcaaacgggccaatcttttccgcttgccgtctgatatgccgattgaagatggc
gcgtttatcgaaccgattaccgtgggcttacacgcctttcatctggcgcagggctgcgag
gggaaaaacgtaattatcgtcggggccgggacaattggcctgctggccttacagtgcgcg
cgggaactgggcgcgcgaagcgtaacggcgattgatatcaatccgcagaaactggaactg
gcgaaagcgctcggcgcaacgcatacctgtaatagccgggaaatgaccgccgacgacatc
cagaccgcgttgtccgacattcagtttgatcaactggttctcgaaacggcaggaactccc
cagaccgtctcgctggctatcgatatcaccgggccgcgcgcgcaactggcgctggtgggg
acgttacatcacgatctcaccctgacgacgcgtacattcgggttaattttgcgtaaagag
ctcacgctcctcggcagttggatgaactactccgcgccatggccaggagaagaatgggaa
accgcagcgcgcctgttggctgaaaaacgtcttcaactgacccctctcattgcccatcgc
ggcgatgcggaaagctttgcagaagcagtcaaagcgcttaatggcgcgcccatgcagggc
aaaatcttacttcaactttcctga

DBGET integrated database retrieval system