KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3479Help
Entry
STY3479           CDS       T00064                                 

Definition
(RefSeq) penicillin-binding protein
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STY3479
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sty01002]
    STY3479
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sty01011]
    STY3479
Enzymes [BR:sty01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STY3479
   3.4.21  Serine endopeptidases
    3.4.21.-  
     STY3479
Peptidases and inhibitors [BR:sty01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   STY3479
Peptidoglycan biosynthesis and degradation proteins [BR:sty01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   STY3479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase TrbL
Motif
Other DBs
NCBI-GeneID: 1249735
NCBI-ProteinID: NP_457679
GeneDB: STY3479
UniProt: Q8Z3H2
LinkDB All DBs
Position
3323177..3324610
Genome map
AA seq 477 aa AA seqDB search
MRFSRFIIGLTTSIAFSVQAANIDEYIKQLPAGANLALMVQKIGAPAPAIDYHSQQMALP
ASTQKVITALAALIQLGPDFRFTTTLETKGNVDNGILKGDLIARFGGDPTLRRQDIRNMV
ATLKKSGVTQIDGNVLIDTSIFASHDKAPGWPWNDLTQCFSAPPAAAIVDRNCFSVSLYS
AQKPNDLAFIRVASYYPVTMFSQVRTLPRGSADAQYCELDVVPGDLNRYTLTGCLPQRAD
PLPLAFAIQDGASYAGAILKQELKEAGITYRGTLLRQTQVNEPGTIVASKQSAPLHDLLK
IMLKKSDNMIADTVFRMIGHVRFNVPGTWRAGSDAVRQILRQQAGIDIGNTIIADGSGLS
RHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGS
LQGVYNLAGFITTASGQRMAFVQYLSGYAVPPADQRNRRIPLVRFESRLYKDIYQNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttccagatttatcatcggattgaccaccagtatagcgttcagcgttcaggcc
gcgaatattgacgaatacatcaaacagcttccggccggcgccaacctcgcgctgatggtg
caaaagattggcgcgcccgcgccggctattgattatcatagtcagcagatggcgcttccc
gccagtacccaaaaggtgattaccgcgctggcggcgctgattcaactcggcccggatttc
cgttttacgaccacgctggagactaaaggcaacgtcgataacggcatcctgaaaggtgac
ttaattgcgcgattcggtggcgatccaacgctaagacgtcaggatattcgcaatatggtc
gcgacgctgaaaaagtcaggcgtcacgcaaatcgacggcaatgtgcttatcgacacgtcg
attttcgccagccacgataaagcgccaggctggccgtggaacgacctgacgcagtgtttc
agcgcgcctcccgccgccgccattgttgaccgcaactgtttttctgtgtcgctttatagc
gcgcaaaaaccaaacgatttagcttttattcgcgtggcctcttattatccggtaacgatg
ttcagccaggtacggactctgccgcgcggttcggcagacgcgcagtattgcgagctggat
gttgtgcctggcgatttgaaccgttatacgcttaccggctgtttaccacagcgcgccgac
ccgctgccgctggcctttgctattcaggacggcgccagctacgcgggcgcgatcctcaag
caggaactgaaagaggccgggataacttaccgcggcacgctgctgcgccagacgcaggtt
aacgagcccggaacgatcgtcgccagtaaacagtcggcgccactgcacgatctgcttaag
attatgctgaaaaagtcagacaacatgatcgccgatactgtttttcggatgattggtcat
gtcaggtttaacgtgcctggcacctggcgggcgggatcggatgctgttcgccagatcctg
cgccaacaggcgggaattgatatcggcaataccattattgccgacggttccggtctttct
cgccataacctgatcgctcccgccacgatgatgcaggtgctgcaatatatcgcccaacac
gataacgagctgaactttatctctatgctgccgctggcgggctatgacggttcattgcaa
taccgcgccggcctacatcaggcgggcgtagacggtaaggtttcggcgaaaaccgggtca
ctgcagggcgtgtacaacctggcgggctttattaccaccgcaagcgggcagcggatggca
tttgtacagtatttgtccggctacgcggttccacctgccgatcagcgtaatcgacgtatt
ccgctggtacgcttcgagagtcgattgtacaaggatatttatcagaataactga

DBGET integrated database retrieval system