KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4564
Entry
STY4564           CDS       T00064                                 

Definition
(RefSeq) hypothetical protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 1250769
NCBI-ProteinID: NP_458650
GeneDB: STY4564
UniProt: Q8Z1K0
LinkDB
Position
4445185..4445457
AA seq 90 aa
MFSLPEMVSAAEKDELALALRQLDQVQSALERAKIVAVQDNSDGRFFFDYERATRDLKTM
KQGIETYLEPSRAQPRDKGSLVGQYRKEQP
NT seq 273 nt   +upstreamnt  +downstreamnt
ttgttctctctgccagagatggtcagtgcagctgaaaaggatgaactggccctcgctctc
aggcagctggaccaggtccagtctgcgcttgaacgcgcgaaaattgtagcggtacaggac
aattctgacgggcgtttcttcttcgactatgagcgggcaacacgtgatttgaaaaccatg
aagcaggggattgaaacttatctggagccttcccgggcacagccaagagacaaaggttct
cttgttggacaatacaggaaggagcagccctga

DBGET integrated database retrieval system