KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000536Help
Entry
SPYALAB49_000536  CDS       T02019                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
stz00620  Pyruvate metabolism
stz00680  Methane metabolism
stz01100  Metabolic pathways
stz01120  Microbial metabolism in diverse environments
stz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPYALAB49_000536
  Energy metabolism
   00680 Methane metabolism
    SPYALAB49_000536
Enzymes [BR:stz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SPYALAB49_000536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Asn_synthase
Motif
Other DBs
NCBI-ProteinID: AEQ24140
LinkDB All DBs
Position
496908..499670
Genome map
AA seq 920 aa AA seqDB search
MPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFAVIESIMVLSEKQDYIELEKV
VANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDTDYLGKLALTIKDLAGKD
NGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRDAKAGVINLEKWRQELYR
YIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKP
ITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAALYRTFSLSSTLVQPNSE
VERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPAARMSSSVGLSTSAWSSP
ASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREVMQAVDIFGFFLASIDMR
QDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQLMEEPRTLSSAAVAKSDLLEKE
LAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFE
TIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNE
LTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGN
KDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVADSNTIYRKLVFDNPHFYD
YFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKR
YIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEI
LDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDEN
DEKLIHTTINGIATGLRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
ttgccacttaaaaagttagagagtagtaacaatcaagctatcattgctgaagaagttgct
cttttgaaagaaatgttggaaaatatcacacgacggatgattggagatgatgcgtttgca
gttatcgagtctattatggtgttatctgaaaaacaagattacatagaattagaaaaagtt
gtcgccaatatttcaaatcaagaaatggaagtgatttccaggtatttttctattttaccc
ttgctaatcaatatttcagaagatgtcgatttagcctatgaaatcaattatcaaaataat
acggatactgattatttaggaaaattagccctaaccatcaaggatcttgctggaaaagat
aatggtaaagacattttggagcaggttaatgtggttcctgttttaacagcacatccgacg
caagtacaacgtaaaacgattctggaattgacaactcacattcataaacttctgcgcaaa
taccgtgatgctaaggctggtgtgattaatcttgagaaatggcgtcaggagctatatcgt
tatattgaaatgatcatgcagacagatattattcgcgagaaaaagcttcaggtgaaaaac
gagataaaaaatgtcatgcagtattacgatggttctctcattcaagcagtgaccaagttg
acaacagagtacaaaaacttagcccaaaaacacggtctagagttagacaatcccaaaccc
attaccatggggatgtggattggtggggaccgtgatgggaacccctttgtcacagctgaa
accttgtgcttgtcagctacggttcaaagtgaggttatcctcaattactacattgacaaa
ttagcagccctttaccgaacattttcactgtcgtcgaccttggtacaacccaactcggaa
gtggaacgtttagccagtttgtctcaggaccaatcgatttaccgtggaaatgaaccttat
cgcagagcttttcattatattcaatcgcgtcttaaacaaacacaaattcaactaactaat
cagccagcagctcgtatgagtagtagtgtgggactaagcacatctgcttggtcttcacca
gctagtttagaaaatcccatcttagcctatgactctcctgttgattttaaagctgatcta
aaggctattgagcagtcgctacttgataatggcaactccgctttgattgagggggatttg
cgagaagtcatgcaagctgttgatatttttggcttcttcttagcaagcattgacatgagg
caagactccagtgtccaagaagcttgtgtggcagagttattaaaaggagccaatattgtt
gacgactatagctctctttcagaaactgaaaaatgcgatgttctcttacaacaattaatg
gaggagccaaggactttatcctcagcggcagttgctaaatcagacctattagaaaaagaa
ctggctatctatactacggcacgagaattgaaagataagcttggagaagaggttataaag
caacatattatttcacatacagaaagtgtctctgatatgtttgagttggccattatgctt
aaagaagtgggattggttgaccagcagcgggctcgtgtgcaaattgttcccctctttgaa
accattgaggatttagataatgcccgtgacatcatggcagcctatttaagccatgacatt
gtcaaatcttggattgcaacgaatcgtaattaccaagaaatcatgttaggctattctgac
agtaataaagatggtggctacttggcatcgggttggactctttataaagctcagaatgaa
ttaacggctattggtgaggaacatggagtgaaaatcaccttcttccatggtcgtggagga
acagttggtcgaggaggtggcccttcttatgatgccattacttcacaaccttttggttcc
atcaaagatcggattcgtctgacagagcaaggggaaattattgaaaacaaatacggcaat
aaagatgtggcttattaccatttagaaatgttgatttcagcttctatcaatcgtatggtg
actcaaatgataacagatcctaatgagattgatagttttcgagaaatcatggatagcatt
gttgctgatagcaataccatttatcgaaaattggtttttgacaatccccatttctatgat
tatttctttgaggcaagcccgattaaggaagtttccagtctcaacattgggtcaagacca
gcagcccgtaaaacgattacggaaattacaggcttgcgtgccattccttgggtcttttca
tggtcacaaaatcgcatcatgttcccaggttggtatggggtaggttcagcctttaaacgt
tatattgaccgagcacaaggtaaccttgaacgcctccaacacatgtatcagacgtggcct
tttttccattccttgttatcaaatgttgatatggtattatctaaatcaaacatgaatatt
gcctttcagtatgcacaactagctgaaagtcaggatgttcgagatgttttttatgaaatt
ttggatgagtggcaattgacaaaaaatgttattcttgctatccaagaccatgatgatcta
ttggaggataatccttcccttaagcatagcttgaagtcacgcttgccgtattttaatgtg
ttgaactatattcaaattgaattgattaaacgttggcgtaataatcaacttgacgaaaat
gatgaaaaattgatccatacaactatcaatggcatagcgactggtttacgtaattcaggc
taa

DBGET integrated database retrieval system