KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_001506Help
Entry
SPYALAB49_001506  CDS       T02019                                 

Definition
(GenBank) aminotransferase class I and II family protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
stz00220  Arginine biosynthesis
stz00250  Alanine, aspartate and glutamate metabolism
stz00290  Valine, leucine and isoleucine biosynthesis
stz01100  Metabolic pathways
stz01110  Biosynthesis of secondary metabolites
stz01130  Biosynthesis of antibiotics
stz01210  2-Oxocarboxylic acid metabolism
stz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPYALAB49_001506
   00290 Valine, leucine and isoleucine biosynthesis
    SPYALAB49_001506
   00220 Arginine biosynthesis
    SPYALAB49_001506
Enzymes [BR:stz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SPYALAB49_001506
    2.6.1.66  valine---pyruvate transaminase
     SPYALAB49_001506
Amino acid related enzymes [BR:stz01007]
 Aminotransferase (transaminase)
  Class I
   SPYALAB49_001506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEQ25084
LinkDB All DBs
Position
complement(1444632..1445846)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELISMSLQALLDNGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGHQSVDALL
LPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgttgcctatgatattcgagggcct
gttttggatgaagctaatcgcatgattgcgagtggtgaaaaaattctgcgtttaaatact
ggcaatcctgctgcttttggttttgaagcaccagatgaagtgattcgtgatttaattgtc
aacgcgaggctaagtgagggctattctgacagtaaagggattttttcagcgcgtaaggct
atcatgcaatattgccaactcaagggcttcccagatgttgacattgaagatatttatttg
ggaaatggcgtgtcagagttgatatccatgtcccttcaagctttgctagataatggcgat
gaagttttagtaccaatgccggattatcctttatggacggcttgtgtgagtcttggtgga
ggaaaagcggtccattatctttgtgatgaagaagctggttggtatcctgatattgctgat
atcaaatcaaaaatcacgagtcgcactaaagctattgtggtcatcaatcctaataaccca
acaggagccctttatcctaaggagattttagaagacatcgttgctttggcaagagaacac
cagctgattatttttgccgatgaaatctatgatcgtttggtgatggatggtaaagagcat
attgctattgcaagtttggcacctgatgttttttgtgtatctatgaatggtctttccaaa
tctcatcgtattgctggttttcgtgttggatggatggtcttatcaggtcctaaagaccat
gttaaaggttacattgaagggttaaacatgcttgccaatatgcggttatgctccaatgtt
ttagcccaacaagttgttcaaacttccttaggaggtcatcaatcagttgatgcactatta
ctgccaggagggcgtatttttgagcaacgtaattttatttatgaagctattaatgctatc
cctggcttatcggcagttaaacctgaagcaggtctttatttatttccgaaaattgatcgt
cagatgtatcgtattgatgatgatgaagaatttgtcttacagttattaaagcaagaaaaa
gtgatgttggtacatggacgtggttttaactggaaagatccagatcacttccgtattgtt
tacctaccaagtgtagaagaattagaagatgtccaagaaaagattacacgtgtcttatac
cagtatagacgttaa

DBGET integrated database retrieval system