KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_001750Help
Entry
SPYALAB49_001750  CDS       T02019                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Brite
KEGG Orthology (KO) [BR:stz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPYALAB49_001750 (ahpF)
Enzymes [BR:stz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPYALAB49_001750 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like Thi4 Glutaredoxin DAO FAD_binding_3 AlaDh_PNT_C Lycopene_cycl Thioredoxin_4 NAD_binding_8 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEQ25313
LinkDB All DBs
Position
1702970..1704502
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDR
QPSFKVAKKGHDSGVVFAGLPLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQIAGPLSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTNNMTIIKNVATKDIVGEDHVTGLNY
TERDSGEDKHLDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccctgttagaagct
gatcttgttttgcaagtttcccttggtgacaatgagcagtctcaaaaagtcaaagacttt
gtggaagaaatagctgctatgtctgagcgtatttctattgaaaacatcactttagaccga
caaccaagctttaaggttgcgaaaaaaggtcacgatagtggggttgtctttgctggtctt
cctttaggccacgaattgacgtcctttattcttgctctcttgcaagtatctggacgtgct
ccaaaagtggatcaagatgttattgatcgcatcaaggccattgaccgtccgttgcatttt
gaaacttatgtcagcttaacctgccataactgcccagatgttgttcaagctttaaacatt
atgtccgtcttgaacgacaagatttcacacactatggtagaaggaggcatgttccaagat
gaagtgaaagccaaaggcattatgtctgtccctactgtctttttagacggggaagaattc
acttctggtcgtgctaccattgagcaactcttagaacaaatcgctggcccactttctgag
gaagcctttgctgataaaggactctatgatgtccttgttattggtggtggccctgcgggc
aatagcgctgctatctatgcagctcgtaaaggactaaaaacaggtttacttgctgaaacc
tttggtggtcaggtcatggaaacggtcggcatcgaaaacatgattggtaccctttacact
gaaggaccaaaattaatggccgaagtggaggcccatactaaatcttatgatgttgatatt
atcaaagcacaactagctacttctattgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttttacaagccaaaactgctatcttagctcttggggccaaatggcgtaac
attaatgttcctggtgaagatgaattccgtaataaaggggtgacttactgccctcactgt
gacggtcctctctttgaaggcaaagatgttgctgttatcggtggtgggaactctggatta
gaagcggcccttgacttggctggtcttgctaaacacgtttacgttttagaattcttgcct
gaacttaaagctgacaaagtgcttcaagaccgcgcagctaagactaacaatatgaccatc
atcaaaaatgttgctactaaggacattgttggagaggaccatgttacaggtcttaactac
actgagcgtgatagcggtgaagacaaacaccttgaccttgaaggggtctttgttcaaatt
ggtcttgttccaaacacagcttggctcaaagatagtggtgtcaacctaaccgaccgcgga
gaaatcattgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttccatggggtctggtgctactgctgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system