KEGG   Sulfurimonas autotrophica: Saut_0488Help
Entry
Saut_0488         CDS       T01316                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00010  Glycolysis / Gluconeogenesis
sua00260  Glycine, serine and threonine metabolism
sua00680  Methane metabolism
sua01100  Metabolic pathways
sua01110  Biosynthesis of secondary metabolites
sua01120  Microbial metabolism in diverse environments
sua01130  Biosynthesis of antibiotics
sua01200  Carbon metabolism
sua01230  Biosynthesis of amino acids
Module
sua_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_0488
  09102 Energy metabolism
   00680 Methane metabolism
    Saut_0488
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saut_0488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sua04131]
    Saut_0488
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sua04147]
    Saut_0488
Enzymes [BR:sua01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Saut_0488
Membrane trafficking [BR:sua04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Saut_0488
Exosome [BR:sua04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Saut_0488
  Exosomal proteins of melanoma cells
   Saut_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADN08537
UniProt: E0UP73
LinkDB All DBs
Position
475240..475938
Genome map
AA seq 232 aa AA seqDB search
MSKARLVLVRHGQSIYNQKNIFTGWTDIDLSEQGIDEAKKAGLLLKKNNIYPDICFTSWL
NRAIHTAQILLKELEWEHIDSLRSYKLNERHYGDWQGRDKDEVKNEYGEEKFLAVRRGYD
VAPPPLKPNDARCVSNDKKYANIDKKLLPLNESLKDTKKRVLEYYSEQIISKLQEQKTVL
ISAHGNSLRALVMELEQISETNIVSFEIPTGEIIVYTFDCDMKIIEKNVLIG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcaaggttggttttggtgcgtcacgggcaaagtatttataatcaaaaaaat
atttttacaggatggacagatattgatttaagtgaacagggcatagatgaagcaaaaaaa
gccggactacttttgaaaaaaaataatatttatccagatatttgctttacatcctggctc
aatcgtgccattcatactgcacagattttgctaaaagagttggagtgggagcatatcgat
tcgcttagaagttataaactcaacgaaaggcactatggtgattggcagggtagagataaa
gatgaggtaaaaaatgaatatggagaagaaaaatttttagccgtaagacgcggctatgat
gtagctccaccaccactcaaacccaatgacgcaagatgtgtttcaaatgataaaaaatat
gcaaatattgataaaaagcttttacccctgaatgaatcgctcaaagatacaaaaaaaaga
gtcttagagtattattcagagcagattatttctaaactgcaggaacaaaaaacagtttta
atttcggcacatggaaactctttacgtgctttggtgatggaattagaacaaatcagtgaa
acaaatatagtctcttttgagataccaacgggagaaataattgtatatacttttgactgt
gatatgaaaattatagagaaaaatgttttaataggttaa

DBGET integrated database retrieval system