KEGG   Sulfitobacter sp. AM1-D1: BOO69_13670Help
Entry
BOO69_13670       CDS       T04555                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
suam  Sulfitobacter sp. AM1-D1
Brite
KEGG Orthology (KO) [BR:suam00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BOO69_13670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: APE44332
UniProt: A0A1J0WJ35
LinkDB All DBs
Position
2787716..2788465
Genome map
AA seq 249 aa AA seqDB search
MLDLTFFLVAGPAVFFAGVSKAGFGSGAAFAAASILALVVEPGLALGVMLPLLMLIDVSS
LRPYWRKWSAPDARLLILGALPGIALGAALYRVASPDLFRLLIGGVSVAFVVWQISLARG
WLRLRRLRLSDRAGLGLGGVVGFTTFVSHAGGPPAAVFLLTRGLTKTQFQATTVLVFWAL
NIIKFVPYAVLGMFTAQTFTANLALAPFALLGTWAGVRAHHLVSERVFFGLTYVLLSITG
AKLIWDGLT
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgctggatttgaccttctttctggtcgccggaccggccgttttctttgccggggtttcc
aaggccgggttcgggtccggggcggcatttgccgcggccagcatcctcgcactggtggtg
gagccgggcctcgcgctcggggtgatgttgccgctgctcatgctgatcgacgtcagttcg
ctgcgcccctactggcggaaatggagcgcgccggacgcccggctgctgattctgggcgcg
ctgcccggcatcgcgctgggtgcggcgctctaccgggtcgcgtcaccggacctgttccgc
ctgctgatcggcggcgtatccgtcgccttcgtggtctggcagatcagccttgcaaggggg
tggctgcggctgcgccggctgcggctgtccgaccgcgccggcctcggccttgggggagtc
gtggggttcaccaccttcgtcagccatgcgggaggcccgcccgcggcggtgttcctgctg
acgcgcggcctgaccaagacccagttccaggcgaccaccgtgctcgtcttctgggcgctc
aacatcatcaagttcgtgccttacgcggttctgggcatgttcaccgcgcagacctttacc
gcgaacctcgcgcttgcgccctttgcgctgctgggcacatgggccggtgtgcgggcgcat
cacctcgtgtcggaaagggtgttcttcggcctgacctacgtgctgctttcgatcacgggg
gccaagctgatctgggatggcctgacctga

DBGET integrated database retrieval system