KEGG   Sulfitobacter sp. AM1-D1: BOO69_13750Help
Entry
BOO69_13750       CDS       T04555                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00020  Citrate cycle (TCA cycle)
suam00310  Lysine degradation
suam00380  Tryptophan metabolism
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
suam01120  Microbial metabolism in diverse environments
suam01130  Biosynthesis of antibiotics
suam01200  Carbon metabolism
Module
suam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOO69_13750
  09105 Amino acid metabolism
   00310 Lysine degradation
    BOO69_13750
   00380 Tryptophan metabolism
    BOO69_13750
Enzymes [BR:suam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BOO69_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: APE44348
UniProt: A0A1J0WJ51
LinkDB All DBs
Position
2799208..2802171
Genome map
AA seq 987 aa AA seqDB search
MTEQPANDQFQASSFLEGQNAEYLEQMYARYANDPAAVDEAWAAFFKAMGDEDSAVKAEA
AGPSWARSDWPPAPAGDDIGALTGVWPDPVEARAAGDKIAAKAQEKGVEVSNQQIRAAVL
DSVRALMLIRAYRIRGHLAAELDPLGMRDTGEHAELDPKSYGFTEADMDRPIFLDNVLGL
EVASMREIVDIVKRTYCGTFALQYMHISDPEQAGWLKERIEGYGKEIAFTKNGRKAILNK
LVEAEGFEKFLHVKYMGTKRFGLDGGESLIPAMEQIIKRGGALGVKEMVIGMPHRGRLSV
LANVMQKPYRAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDREFDGNTVHLSLTANPSHL
EAVNPVVLGKARAKQDQLNDSDRTKVMPILLHGDAAFAGQGVVAECFALSGLRGHRTGGT
MHIVVNNQIGFTTAPHFSRSSPYPTDNALVVEAPIFHVNGDDPEAVVHAAKVATEFRQKF
HKDVVIDMICYRRFGHNEGDEPMFTNPIMYKKIKGQKTTLSLYADRLVKDGLVPEGEIED
MKADFQKKMNEEFEAGKDYRPNKADWLDGKWSHLDKSKEKKYQRGKTAISKDTLADVGKA
LTTVPDDFPLHKTVGRLLEAKQAMFRDGEGFDWATAEAIAFGSLLTEGYKVRLAGQDSAR
GTFSQRHSALINQETEDRYYPLNHIREGQAEYEVIDSMLSEYAVLGFEYGYSLAEPNALT
LWEAQFGDFANGAQIMFDQFISSGESKWLRMSGLVCLMPHGYEGQGPEHSSARLERFLTM
CGGDNWIVANCTTPANYFHLLRRQLHRSYRKPLMLMTPKSLLRHKLAISRAEDFTTGSSF
HRVLWDDAEKGNSDTQLVADDKIKRVVMCSGKVYYDLLEERDSRGIDDIYLLRFEQFYPF
PAQSSVKELERFKNAEMVWCQEEPKNQGGWSFIEPNIEWVLGRIGAKHGRPTYVGRATSA
SPATGLASQHKAQQAALVDEALTIEGK
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagccagccaacgaccagttccaggcgtcgtccttcctcgaaggtcagaat
gccgagtacctcgaacagatgtacgcgcgatacgccaacgaccccgccgcggtggacgag
gcatgggccgcgttcttcaaggcgatgggcgacgaagactcggccgtgaaggccgaggcg
gcgggcccgtcctgggcgcgcagcgactggcctccggccccggcgggagacgacatcggc
gcgctgacgggcgtgtggccggacccggtcgaagcccgcgccgcgggcgacaagatcgcc
gccaaggcccaggagaagggggtcgaggtctcgaaccagcagatccgcgccgcggtgctc
gactccgtccgcgcgctcatgctgatccgcgcctaccggatccggggccatctcgcggcc
gagcttgacccgctgggcatgcgcgacaccggcgagcacgcggaactggacccgaaatcc
tacgggttcaccgaggcggacatggaccgcccgatctttctcgacaacgtgctggggctc
gaagtggcgagcatgcgcgagattgtcgatatcgtgaagcgcacctactgcggcaccttc
gcgttgcagtacatgcacatctccgaccccgaacaggccgggtggctcaaggaacgcatc
gaaggctacggcaaggagatcgcctttaccaagaacggacgcaaggcgatcctgaacaag
ctggtggaggccgagggcttcgagaagttcctgcacgtcaagtacatgggcaccaagcgc
ttcggcctcgacggcggcgaaagcctgatccccgcgatggagcagatcatcaagcgcggc
ggtgccctgggcgtcaaggagatggtcatcggcatgccccaccgtggccgcctgtcggtg
ctggccaacgtgatgcagaaaccctaccgggcgatcttcaacgaattccagggcggcagc
ttcaagcccgaggacgtggacggatccggcgacgtgaaatatcacctcggtgcctcgtcc
gaccgtgaattcgacggcaacaccgtgcacctgagcctgaccgcgaaccccagccacctc
gaggcggtcaatcccgtggttctgggcaaggcacgcgccaagcaggaccagctgaacgac
agcgaccgcaccaaggtcatgccgatcctgctgcacggcgatgcggccttcgcgggccag
ggcgtggtggcggaatgcttcgcgctgtcggggctgcgcgggcacaggaccggcgggacc
atgcacatcgtggtgaacaaccagatcggctttaccaccgcgccgcacttctcgcgctcc
tcgccctatcccaccgacaacgcgctggtggtcgaggcgccgatcttccacgtgaacggc
gacgatccggaggcggtcgttcatgccgccaaggtggcgacggaattccgccagaaattc
cacaaggacgtggtgatcgacatgatctgctaccgccgcttcggtcacaacgaaggcgac
gagccgatgttcaccaacccgatcatgtacaagaagatcaagggccagaagaccacgctc
agcctctatgccgaccgtctggtcaaggacggcctcgtccccgagggcgagatcgaggac
atgaaggccgacttccagaagaagatgaacgaggaattcgaggccggaaaggactaccgc
ccgaacaaggccgactggctggacggcaagtggtcgcacctcgacaagtcgaaggagaag
aaataccagcgcggcaagaccgcgatctccaaggacacccttgccgacgtcggcaaggcc
ctgacaacggtccccgacgacttcccgctgcacaagacggtgggccgtctgctggaggcg
aagcaggcgatgttccgcgacggcgaaggtttcgactgggccacggccgaggccatcgcc
ttcgggtccctcctgaccgagggctacaaggtccgccttgccggacaggacagcgcccgc
ggcaccttcagccagcggcattcggccctgatcaaccaggagaccgaggaccgctactat
ccgctgaaccacatccgcgagggtcaggcggaatacgaagtcatcgattccatgctgtcc
gaatacgcggtgctgggtttcgaatacggctattcgctggccgaacccaacgcgctgacc
ctgtgggaagcccagttcggcgacttcgccaacggcgcgcagatcatgttcgaccagttc
atcagctcgggcgagagcaaatggctgcgcatgtccggtctcgtctgcctgatgccgcac
ggctacgaagggcaagggcccgaacactcctccgcgcggctcgaacggttcctgacgatg
tgcggcggcgacaactggatcgtggcgaactgcaccacgccggccaactacttccacctg
ctgcgccgccagctgcaccgcagctaccgcaagccgctcatgctgatgacgccgaaatcg
ctcctgcgccacaagctggcgatcagccgggccgaggattttaccaccggcagcagtttc
caccgcgtcttgtgggacgacgccgaaaaggggaactccgacacccagctggtggcggac
gacaagatcaagcgggtcgtgatgtgttcgggcaaggtctactacgacctgctggaagaa
cgcgacagccgcggcatcgacgacatctacctgctgcgtttcgaacagttctatcccttc
ccggcgcagtcttcggtcaaggaactggaacggttcaagaacgccgaaatggtctggtgt
caggaagaacccaagaaccagggcgggtggagcttcatcgagccgaacatcgaatgggtt
cttggccgcatcggcgcgaaacacggccgccccacctacgtcggccgcgcgacatccgcc
tcgcccgcgacggggctggcaagccagcacaaagcacaacaagccgctctcgttgacgaa
gcgctgaccatcgaaggaaagtaa

DBGET integrated database retrieval system