KEGG   Sulfitobacter sp. AM1-D1: BOO69_19175Help
Entry
BOO69_19175       CDS       T04555                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00860  Porphyrin and chlorophyll metabolism
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BOO69_19175
Enzymes [BR:suam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     BOO69_19175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB MipZ AAA_26 NB-ARC CBP_BcsQ
Motif
Other DBs
NCBI-ProteinID: APE45680
UniProt: A0A1J0WNE6
LinkDB All DBs
Position
unnamed1:complement(124150..125049)
Genome map
AA seq 299 aa AA seqDB search
MSPLDKGIPHLRGQDGEGSVQVHQDESARIEGAKVFSVYGKGGIGKSTTSSNLSAAFSML
GKRVLQIGCDPKHDSTFTLTGSLVPTVIDILKEVDFHPEELRAEDFVFEGFNGVKCVEAG
GPPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVIFDVLGDVVCGGFAAPLQHADRALIVTA
NDFDSIYAMNRIIAAVQAKSANYKVRLAGCVANRSKDTDEVDRYCATVGFNRIAHMPDLD
AIRRSRLKKKTLFEMDLDDEIAAVQKEYIRLAETLWNGTEPLAPAPLPDREIFELLGFD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcccactcgacaaaggcatcccgcatctgcgcggccaggacggtgaaggatcggtg
caggtgcatcaggacgaaagcgccaggatcgaaggcgccaaggtcttcagcgtctacggc
aagggcgggatcggcaaatcgaccacctcgtcgaacctgtcggcggccttttcgatgctg
ggcaagcgggtcttgcagatcggatgcgaccccaagcacgacagcaccttcacactgacc
ggctcgctggtgccgacggtcatcgacatcctcaaggaggtcgatttccaccccgaggaa
ctgcgcgccgaggacttcgtcttcgaagggttcaacggcgtgaaatgcgttgaggcaggc
ggcccgcccgcgggcaccggctgcggcggctacgtcgtgggccagacggtcaaactgctc
aagcagcaccacctgctggaagacaccgacgtggtgatcttcgacgtgctgggtgacgtg
gtctgcggcggtttcgccgcgccgttgcaacacgccgaccgggcgctgatcgtgaccgcc
aacgacttcgacagcatctatgccatgaaccgcatcatcgcggccgtgcaggcaaaatcg
gccaactacaaggtccgccttgccggctgtgtcgcgaaccggtcgaaagacaccgacgag
gtggaccgctattgcgccaccgtggggttcaaccgcatcgcccatatgcccgacctcgac
gccatccgccgctcgcggctcaagaagaagaccctcttcgagatggacctcgatgacgag
atcgcggcggtacagaaggaatacatccgcctcgcggagaccctgtggaacggcacggag
ccgctggcgcccgcgcccctccccgaccgggaaatcttcgagcttctgggattcgattga

DBGET integrated database retrieval system