KEGG   Streptococcus uberis: SUB0353Help
Entry
SUB0353           CDS       T00849                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07015  uncharacterized protein
Organism
sub  Streptococcus uberis
Brite
KEGG Orthology (KO) [BR:sub00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SUB0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase PGP_phosphatase Hydrolase_3 DUF934 VPS53_C Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: CAR40946
UniProt: B9DTM3
LinkDB All DBs
Position
355829..356356
Genome map
AA seq 175 aa AA seqDB search
MSIDDYRPTFMVEAVYDLRADDLLRHGITAVFVDLDNTLIAWNNPDGTPEVRAWLDEMTI
ADISVVVVSNNNYKRVERAVSRFGVDFISRAMKPFARGINIAIERYGFNRSEVIMVGDQL
MTDIRASHRAGIKSVLVKPLVKSDAWNTKINRFREKRVFSKLEKKYGKLTYQKGI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgacgattataggccgacctttatggtcgaagcagtatacgatttaagagct
gatgatttacttagacatggaattacagcagtatttgttgatttagataatacattaatt
gcttggaataatcctgatggaactcctgaagtgagagcctggttagatgaaatgacaatt
gcagatatatctgttgttgttgtttccaacaacaattataaaagggtagaaagagcagta
tcgcgttttggtgttgattttataagtagagcaatgaaaccatttgctcgtggtattaat
attgcaattgagcgttacggttttaatcgtagtgaagtgatcatggttggtgaccaacta
atgactgatatcagagcaagtcatcgagcaggaattaagtcggttctcgtaaaaccattg
gtcaagtctgatgcatggaatacgaaaattaatcgttttagagaaaaacgagttttttca
aaactagaaaaaaagtatggtaaattaacataccaaaaaggaatttaa

DBGET integrated database retrieval system