KEGG   Streptococcus uberis: SUB0537Help
Entry
SUB0537           CDS       T00849                                 

Definition
(GenBank) putative alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sub  Streptococcus uberis
Pathway
sub00500  Starch and sucrose metabolism
sub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SUB0537
Enzymes [BR:sub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SUB0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CAR41297
UniProt: B9DU10
LinkDB All DBs
Position
506523..507986
Genome map
AA seq 487 aa AA seqDB search
MTNELMFQAFEWYLPDDHNHWKRLREAIPDFQKMGISKIWLPPAFKGTGSNDVGYGIYDL
FDLGEFDQNGTVPTKYGSKEDYLALTAALNEADIMPIADIVLNHKANADQKETFHVLKMN
PDNRQEPISEPYEIEGWTGFTFPGRQGKYNDFTWHWYHFTGLDYDARHNETGIFLITGDN
KGWANQESVDNEKGNFDYLMFNDIDFKHPEVQEHLKVWAKWFLDTTAVKGFRLDAIKHID
ANFMNNFIRYVRDHFAEDLFVFGEYWKDDSDATHHYLDEVDMQFNLVDVALHMNFYEASH
SGNAFDMTKIFESSLMQSHPDFAITFVDNHDTQSGQALQTRVEDWFKPLAYGLILLRQEG
MPCLFYGDYYGIEGDFGQMSFKDILEKLTYLRQKTVYGKQVDYFDHANCIGWTQLGNDDS
DTCLAVVMTNGDRGWKHMEVGQLYVGQTFVDYLGHCPDEIMINEDGWADFKVEPGSISAW
VPKSFLA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaattaatgtttcaagcttttgaatggtatttaccagatgatcacaatcat
tggaagaggttaagagaagccatcccagactttcaaaaaatgggaatcagtaaaatctgg
ttacctcctgcattcaaaggaacaggctctaacgatgtggggtatggtatttatgactta
tttgatttgggagagtttgatcaaaacggtacagttccaacgaaatatggcagtaaggag
gactatttagctttaacagctgccttaaatgaagcagacattatgccaattgcagatatt
gtcctcaatcataaagctaatgctgatcaaaaagaaacctttcatgttcttaaaatgaat
cctgataacagacaagagcctatttctgaaccctatgaaattgaagggtggacgggcttt
acctttccaggtcgtcaaggcaaatataatgattttacgtggcactggtatcattttaca
ggattggattacgatgctcgacacaatgaaactggtatttttttaatcacaggagataat
aaaggttgggctaatcaagaaagtgttgataatgaaaagggcaattttgattacttgatg
tttaatgatattgattttaaacatccagaagttcaagaacatcttaaggtctgggccaaa
tggtttttagataccacagctgtcaaaggatttcgtttggatgctatcaaacatattgat
gccaactttatgaataactttattcgctacgttcgtgatcattttgctgaggatctcttt
gtttttggtgagtattggaaagacgatagcgatgctactcaccattatttggatgaagtt
gacatgcaatttaatcttgttgacgttgcactccacatgaacttttatgaagccagtcat
tcaggtaatgcttttgatatgacaaaaatctttgaatctagcttaatgcaaagccatcca
gattttgccataacctttgttgacaatcatgatactcaaagtggacaagccttacaaacc
cgtgtagaagattggtttaaacctttagcttacggactcatacttttaagacaagaagga
atgccatgtctattttatggtgactactatggaatagaaggtgactttggtcaaatgtct
tttaaagatattttagagaaactcacttatcttcgtcaaaaaacagtttatggaaaacaa
gtagattactttgatcatgctaattgtattggttggactcagttggggaacgatgacagt
gatacctgtttagcggttgtcatgacaaatggtgacagaggttggaaacacatggaagta
gggcaactttatgtcggtcaaacttttgtggattaccttggacattgcccagatgaaata
atgattaatgaggatggttgggcagatttcaaagttgaaccgggttccatatcagcttgg
gttccaaaatcctttttagcataa

DBGET integrated database retrieval system