KEGG   Streptococcus uberis: SUB1086Help
Entry
SUB1086           CDS       T00849                                 

Definition
(GenBank) haloacid dehalogenase-like hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sub  Streptococcus uberis
Pathway
sub00627  Aminobenzoate degradation
sub01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sub00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SUB1086
Enzymes [BR:sub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SUB1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: CAR42397
UniProt: B9DSE4
LinkDB All DBs
Position
complement(1057559..1058323)
Genome map
AA seq 254 aa AA seqDB search
MTYKGYLIDLDGTIYKGRERIPAGERFIQRLQEQEIPYLLVTNNTTRTPQMVQDMLAQQF
NIQTPLETIYTATMATVDYMKDMNRGQTAYVIGETGLKSAISEAGYIEDKENPAYVVVGL
DSQVTYDMLATATLAIAKGALFIGTNPDLNIPTERGLMPGAGSLVALLEAATRVKPVFIG
KPNAIIMNKALDILQVKRSEAIMVGDNYLTDIMAGIQNDIASLLVTTGFTKAEEVPNLPI
QPDYVVASLDEWDI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgacatacaaaggctatttaattgatttagacggaacgatttataaaggtagggaacgg
attcctgctggggaacgctttattcagaggcttcaagagcaagagattccatacctctta
gtgacaaacaacaccactcggacaccccagatggttcaggacatgttggcgcagcaattc
aacatccaaacccccttggagactatctacacggcaaccatggcgacggtggactacatg
aaggacatgaaccgcgggcaaacggcttatgtgattggtgagactggactcaaatcagct
atttcagaggctggctacattgaggacaaggagaaccctgcttatgttgtcgttggactt
gatagtcaggtgacttatgacatgttggcaacggcgactctggctatcgccaaaggtgcc
ctttttattggaactaacccagacctcaatattccaacagagagaggattgatgccggga
gccggctccttggtggccctattagaagcggcaacgcgtgtcaaaccggttttcattggc
aaacccaatgccattatcatgaacaaagccttggatatcttacaggtcaaacgctctgaa
gctatcatggttggggataattatctaacagacatcatggctggtattcaaaatgatatt
gctagcttactggtgacgactggttttacaaaagcagaagaagtgccaaacttgccgatt
caaccggattatgttgtggctagcttagacgagtgggacatctaa

DBGET integrated database retrieval system