KEGG   Streptococcus uberis: SUB1242Help
Entry
SUB1242           CDS       T00849                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sub  Streptococcus uberis
Brite
Enzymes [BR:sub01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SUB1242 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAR42712
UniProt: B9DUQ5
LinkDB All DBs
Position
complement(1228113..1228721)
Genome map
AA seq 202 aa AA seqDB search
MAIILPDLPYAYDALEPQIDKETMTLHHDKHHATYVANANAALEKHPEIGEDLVALLSDV
SSIPEDIRQALINNGGGHLNHALFWELLSPEKTEITSEVASAIDEAFGSFDAFKEKFTAA
ATGRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKQPILGLDVWEHAYYLNYRNVRPNY
IKAFFEIINWKKVDELYKAAKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttacctgaccttccatatgcatatgatgctcttgagccacaaattgat
aaagaaacaatgactcttcatcatgacaaacatcatgcgacatatgttgctaatgccaat
gctgcgcttgaaaaacatccagaaattggtgaagatttggtggcgttattatctgatgtg
tcatcaattccagaagatattcgtcaagctcttatcaataatggaggcggacatcttaac
catgcacttttttgggaacttctttcacctgagaaaacagaaatcacttcggaagtagct
tctgctattgatgaagcatttggttcttttgatgcatttaaagaaaaatttacagcagca
gcaacgggacgttttggatctggttgggcttggttagttgtcaataaagaaggaaaactt
gaagtaacttcaactgcaaaccaagatacaccaatttctgaaggtaaacagcctattttg
ggtcttgatgtatgggaacatgcttattacttaaattatcgtaatgtacgtccaaattac
attaaagctttctttgaaattattaattggaaaaaggttgatgagctttataaagcagca
aaagcgtaa

DBGET integrated database retrieval system