KEGG   Streptococcus uberis: SUB1529Help
Entry
SUB1529           CDS       T00849                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sub  Streptococcus uberis
Pathway
sub00220  Arginine biosynthesis
sub00250  Alanine, aspartate and glutamate metabolism
sub00290  Valine, leucine and isoleucine biosynthesis
sub01100  Metabolic pathways
sub01110  Biosynthesis of secondary metabolites
sub01130  Biosynthesis of antibiotics
sub01210  2-Oxocarboxylic acid metabolism
sub01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SUB1529
   00290 Valine, leucine and isoleucine biosynthesis
    SUB1529
   00220 Arginine biosynthesis
    SUB1529
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sub01007]
    SUB1529
Enzymes [BR:sub01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SUB1529
    2.6.1.66  valine---pyruvate transaminase
     SUB1529
Amino acid related enzymes [BR:sub01007]
 Aminotransferase (transaminase)
  Class I
   SUB1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Beta_elim_lyase Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAR43275
UniProt: B9DVH7
LinkDB All DBs
Position
complement(1516786..1518000)
Genome map
AA seq 404 aa AA seqDB search
MKIFEKSSKLEHVAYDIRGPVLEEAERMMANGEKILRLNTGNPAAFGFEAPDEVIRDLIL
NARNSEGYSDSRGIFSARKAIMQYCQLKDFPEVDINDIYLGNGVSELISMSMQALLDDGD
EVLVPMPDYPLWTACVSLAGGKAVHYICDEQAEWYPDIDDIKSKVTDRTKAIVIINPNNP
TGALYPKELLEEIVDIAREHQLIIFADEIYDRLVMDGGKHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKNHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGHQSVDDLL
LPGGRIFEQRNFIHKAINDIPGLSAVKPKAGLYIFPKIDRQMYRIDDDEQFVLDLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPRVEELADVQEKITRVLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttttgagaaatcatcaaaactagaacatgttgcctatgacattcgtggtcct
gttttagaagaggctgaacgtatgatggcaaatggtgaaaaaatccttcgtcttaataca
ggaaatccggctgccttcggatttgaagcccctgatgaagttattagagacttaattctg
aatgctcgaaatagtgaggggtattcagatagtagaggcattttttctgccagaaaagcg
attatgcaatactgtcaattaaaagactttcctgaagttgacattaatgacatttatctt
ggcaatggtgtatctgagttaatatctatgtccatgcaggctttacttgatgatggtgat
gaggttttagtaccaatgcctgattatcccttgtggacagcctgtgtcagtttagctggc
ggtaaagcggtgcattacatttgtgatgagcaagcagaatggtatcccgatatcgatgat
attaagtctaaagtaactgacagaacaaaagcaattgttattattaatccaaacaatccc
actggagctctttatccaaaagaattattagaggaaattgttgacattgctcgagaacat
cagttaattatttttgctgacgaaatttatgatcgtctcgtgatggatggtggtaaacat
attgcaattgctagtctagctccggatgttttttgtgtctcaatgaatggtttatcaaaa
tcccatcgtattgctggtttccgtgttggatggatggtcctttctggtcctaaaaaccat
gtgaaaggttatattgaaggtctcaatatgctggcaaatatgcgtttatgttcaaatgtc
ttagcacagcaagttgtacaaacgtcattgggagggcatcagtctgttgatgatttatta
ttacctggtggtcggatttttgagcaacgtaattttatccacaaagccatcaatgatatc
cctggattatcagctgtcaaacctaaggcaggtctttatattttccctaaaattgatcgt
caaatgtaccgtattgatgatgatgaacaatttgtgttagaccttttgaaacaggaaaaa
gtaatgctagttcacggaagaggatttaactggaaagatccagatcacttccgaattgtt
tacttacctagagtagaagaattggcagatgttcaagagaaaatcacacgtgttttaaaa
cagtataagcgttaa

DBGET integrated database retrieval system