KEGG   Streptococcus uberis: SUB1753Help
Entry
SUB1753           CDS       T00849                                 

Gene name
ndh
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sub  Streptococcus uberis
Brite
KEGG Orthology (KO) [BR:sub00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SUB1753 (ndh)
Enzymes [BR:sub01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SUB1753 (ndh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like Thi4 AlaDh_PNT_C NAD_binding_7 FAD_binding_3 DAO NAD_binding_8 Glutaredoxin Lycopene_cycl FMO-like K_oxygenase LPD7
Motif
Other DBs
NCBI-ProteinID: CAR43720
UniProt: B9DW40
LinkDB All DBs
Position
1737580..1739112
Genome map
AA seq 510 aa AA seqDB search
MALTSEIKAQLKQYLDLLESDIVLQTDFGNNDNSSKMKAFIDEIVAMSDRISTEAVSLSR
QPSFTIAQKGTAGRVSFAGIPLGHEFTSFILALLQVSGRPPKIDQDLIKRIKGIEKPMHF
ETYASLTCHNCPDVVQAFNIMAVLNPKISHTMIEGGMFQDEVTEKGIMSVPTVYFENEVF
HSGRATIEQLVDKVAGPLSESAFTDKGTYDVLVIGGGPAGNSAAIYAARKGLKTGLIAET
FGGQVMETVGIENMIGTLYTEGPQLMAQIEAHTKSYPVDIIKSQVVTKIDKKDLVSVSLA
NGAVLNAKTAILALGAKWRNVNVPGEEEFRTKGVTNCPHCDGPLFEGKDVAVIGGGNSGM
EAALDLAGICKHVTVLEFLPEVKADQVLQNRTAKTDNVTIITNAATKEIIGDEHVTGIRY
TDRETNEEKQIDLEGVFVQIGLVPSTQWLKDSGITLTERGEIVVDAHGMTSIPGIFAAGD
CTNSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccttaacttctgaaatcaaagcccaactcaaacaatatttagacttacttgaatct
gatattgtcttacaaacggatttcggtaacaatgataactcctcaaaaatgaaagcattt
atcgatgagattgttgccatgtcagatcgaatcagtaccgaagctgtttcattatcaaga
caacctagttttactattgcccaaaaaggaacagctggacgtgtgtcatttgcaggtatc
cctcttggacacgagttcacatcctttatcttggctttattacaagtctctggacgacca
ccaaaaattgaccaagatctcattaaacgcattaagggtatcgaaaaacccatgcatttt
gaaacctatgccagcttgacttgccataactgtcctgacgttgtccaagccttcaatatc
atggccgtcctaaatccaaagatcagtcacaccatgattgaaggaggcatgttccaagat
gaagtgaccgaaaaaggaattatgtctgtaccgacagtttactttgaaaatgaagtcttt
cattctggccgtgcaactatcgaacagctagttgataaggtagctggacctttgtcagaa
tcagcctttacagacaaagggacctacgatgttcttgtcattggtggcgggcccgcaggt
aacagcgcagccatttatgctgcaagaaaaggcttgaaaactggccttattgcagaaact
tttggtgggcaagtcatggaaaccgtcggaattgaaaatatgattggtaccctttataca
gaaggacctcaactgatggcccaaattgaggcgcataccaagtcttatcctgttgatatc
atcaagtcacaagtggtaacaaagattgacaagaaagatttggtctccgtttctttagca
aatggtgccgtattaaatgcaaaaacagccattctagctttaggagccaaatggcgaaac
gttaatgttcctggggaagaagaattccgaactaagggtgtcaccaactgtccacattgt
gacggaccgctctttgaaggaaaagatgttgctgttattggcggtggaaattctggtatg
gaggccgcattggatcttgcaggaatctgtaagcatgttacggttcttgaattcttacca
gaagtcaaagctgaccaggtcttacaaaatcgcactgctaaaacagataatgtcactatt
atcaccaatgccgcaaccaaagaaattattggcgatgagcatgtgacaggtattcgttac
acagaccgtgaaaccaatgaggaaaaacaaattgatcttgaaggagtttttgttcaaatt
ggtctggtacctagcacacaatggctaaaagatagtggtatcactttaactgaacgtggg
gaaattgtggttgatgctcacgggatgacatcaatccctggcattttcgcagcaggagat
tgcaccaactcagcctataaacaaatcattatttcaatgggttcaggagccacagctgct
attggagcttttgactatttgattagacaatag

DBGET integrated database retrieval system