KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_1076Help
Entry
ECTR2_1076        CDS       T01887                                 

Definition
(GenBank) PASTA domain protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Brite
KEGG Orthology (KO) [BR:suc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:suc01001]
    ECTR2_1076
Enzymes [BR:suc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ECTR2_1076
Protein kinases [BR:suc01001]
 Serine/threonine kinases: Other
  Bacterial family
   ECTR2_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RIO1 Sigma_reg_N Choline_kinase Kinase-like Kdo ETRAMP PNPase
Motif
Other DBs
NCBI-ProteinID: CBX34456
LinkDB All DBs
Structure
PDB: 

Position
1160905..1162899
Genome map
AA seq 664 aa AA seqDB search
MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
LSNVILRATEKDKANRYKTIQEMKDDLSGVLHENRANEDVYELDKMKTIAVPLKKEDLAK
HISEHKSNQPKRETTQVPIVNGTAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLM
IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
YDDI
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaaataataaatgaacgatataaaattgtagataagcttggcggcggtggc
atgagtaccgtttatcttgcagaagatacgatacttaacattaaagttgcaattaaggcg
atttttataccacctagagaaaaagaagaaacattaaaacgttttgaacgagaagtacat
aactcatcacagctatcacatcaaaatatagtaagtatgatcgatgttgatgaagaagat
gactgttactacttagtaatggaatatattgaaggtccgactttgtctgagtatattgaa
agtcatgggccattaagtgttgacacggcgattaattttacgaatcaaatattggatggc
attaaacatgcgcatgatatgcgtattgtacatagagatattaagccacaaaatatatta
attgacagcaataaaacgttgaaaatatttgattttggaattgctaaagctttaagtgag
acgtctttaactcagactaatcatgtgttaggtactgtgcagtacttttcgccagaacaa
gcaaaaggtgaggcaacggatgaatgtacagatatttattctataggtattgtgttatat
gaaatgcttgttggtgaaccaccctttaatggagaaactgcagttagcattgcgattaaa
catattcaggattctgtgccaaatgtgacaacagatgtacgtaaggatattccgcaatct
ttaagtaatgtcattttacgcgctacagaaaaagacaaagcgaatcgttacaaaacaatt
caagaaatgaaagatgatttgagtggtgttttacatgaaaatcgagcgaatgaagatgtc
tatgaactcgataaaatgaaaacgatagcggtacctttgaaaaaagaagatctagcaaag
catattagtgaacataagtcgaatcaacctaaacgtgaaacgacgcaagtacctattgta
aatgggactgctcatcatcagcaattccaaaagccagaaggtacggtgtacgaaccaaaa
cctaaaaagaaatcaacacgaaagattgtgctcttatcactaatcttttcgttgttaatg
attgcacttgtttcttttgtggcaatggcaatgtttggtaataaatacgaagagacacct
gatgtaatcgggaaatctgtaaaagaagcagagcaaatattcaataaaaacaacctgaaa
ttgggtaaaatttctagaagttatagtgataaatatcctgaaaatgaaattattaagaca
actcctaatactggtgaacgtgttgaacgtggtgacagtgttgatgttgttatatcaaag
ggccctgaaaaggttaaaatgccaaatgtcattggtttacctaaggaggaagcattgcag
aaattaaaatcgttaggtcttaaagatgttacgattgaaaaagtatataataatcaagcg
ccaaaaggatacattgcaaatcaaagtgtaaccgcaaatactgaaatcgctattcatgat
tctaatattaaactatatgaatctttaggcattaagcaagtttatgtagaagactttgag
cataaatcctttagcaaagctaaaaaagccttagaagaaaaagggtttaaagttgaaagt
aaggaagagtatagtgacgatattgatgagggtgatgtgatttctcaatctcctaaagga
aaatcagtagatgaggggtcaacgatttcatttgttgtttctaaaggtaaaaaaagtgac
tcatcagatgtcaaaacgacaactgaatcggtagatgtaccatacactggtaaaaatgat
aagtcacaaaaagttaaagtttatattaaagataaagataatgacggttcaactgaaaaa
ggtagtttcgacattactagtgatcaacgtatagacattcctttaagaattgaaaaagga
aaaacagcaagttatattgttaaagttgacggtaaaactgtagctgaaaaagaagtcagc
tatgatgatatttaa

DBGET integrated database retrieval system