KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_1156Help
Entry
ECTR2_1156        CDS       T01887                                 

Definition
(GenBank) glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Brite
KEGG Orthology (KO) [BR:suc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:suc02000]
    ECTR2_1156
Transporters [BR:suc02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    ECTR2_1156
Ion channels [BR:suc04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   ECTR2_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: CBX34536
LinkDB All DBs
Position
1255149..1255967
Genome map
AA seq 272 aa AA seqDB search
MNVYLAEFLGTAILILFGGGVCANVNLKRSAANGADWIVITAGWGLAVTMGVFAVGQFSG
AHLNPAVSLALALDGSFDWSLVPGYIVAQMLGAIVGATIVWLMYLPHWKATEEAGAKLGV
FSTAPAIKNYFANFLSEIIGTMALTLGILFIGVNKIADGLNPLIVGALIVAIGLSLGGAT
GYAINPARDLGPRIAHAILPIAGKGGSNWSYAIVPILGPIAGGLLGAVVYAVFYKHTFNI
GCAIAIVVVIITLILGYILNKSSKKGDIESIY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtatatttagcagaattcctaggaactgcaatcttaatcctttttggtggtggc
gtttgtgccaatgtcaatttaaagagaagtgctgcgaatggtgctgattggattgtcatc
acagctggatggggattagcggttacaatgggtgtgtttgctgtcggtcaattctcaggt
gcacatttaaacccagcggtgtctttagctcttgcattagacggaagttttgattggtca
ttagttcctggttatattgttgctcaaatgttaggtgcaattgtcggagcaacaattgta
tggttaatgtacttgccacattggaaagcgacagaagaagctggcgcgaaattaggtgtt
ttctctacagcaccggctattaagaattactttgccaactttttaagtgagattatcgga
acaatggcattaactttaggtattttatttatcggtgtaaacaaaattgccgatggttta
aatcctttaattgtcggagcattaattgttgcaatcggattaagtttaggcggtgctact
ggttatgcaatcaacccagcacgtgatttaggtccgagaattgcacatgcgattttacca
atagctggtaaaggtggttcaaattggtcatatgcaatcgttcctatcttaggaccaatt
gccggtggtttattaggtgcagtggtatacgctgtattttataaacatacatttaatatt
ggttgtgcaattgcaattgttgtagttattattactttgattttaggttacattttaaat
aaatcatcaaaaaaaggtgatatcgaatcaatttactaa

DBGET integrated database retrieval system