KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_131Help
Entry
ECTR2_131         CDS       T01887                                 

Definition
(GenBank) acetaldehyde dehydrogenase 2 (Acetaldehyde dehydrogenaseII) (ACDH-II)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00010  Glycolysis / Gluconeogenesis
suc00053  Ascorbate and aldarate metabolism
suc00071  Fatty acid degradation
suc00280  Valine, leucine and isoleucine degradation
suc00310  Lysine degradation
suc00330  Arginine and proline metabolism
suc00340  Histidine metabolism
suc00380  Tryptophan metabolism
suc00410  beta-Alanine metabolism
suc00561  Glycerolipid metabolism
suc00620  Pyruvate metabolism
suc00625  Chloroalkane and chloroalkene degradation
suc01100  Metabolic pathways
suc01110  Biosynthesis of secondary metabolites
suc01120  Microbial metabolism in diverse environments
suc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECTR2_131
   00053 Ascorbate and aldarate metabolism
    ECTR2_131
   00620 Pyruvate metabolism
    ECTR2_131
  Lipid metabolism
   00071 Fatty acid degradation
    ECTR2_131
   00561 Glycerolipid metabolism
    ECTR2_131
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECTR2_131
   00310 Lysine degradation
    ECTR2_131
   00330 Arginine and proline metabolism
    ECTR2_131
   00340 Histidine metabolism
    ECTR2_131
   00380 Tryptophan metabolism
    ECTR2_131
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECTR2_131
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECTR2_131
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECTR2_131
Enzymes [BR:suc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ECTR2_131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: CBX33534
LinkDB All DBs
Position
151157..152644
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtaaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system