KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_794Help
Entry
ECTR2_794         CDS       T01887                                 

Definition
(GenBank) pyridine nucleotide-disulphide oxidoreductase family protein
  KO
K03885  NADH dehydrogenase [EC:1.6.99.3]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:suc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECTR2_794
Enzymes [BR:suc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     ECTR2_794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 K_oxygenase NAD_binding_8 NAD_binding_9 DAO Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBX34177
LinkDB All DBs
Position
complement(861764..862828)
Genome map
AA seq 354 aa AA seqDB search
MKNLVLLGGGYGNMRIMSRILTTSLPQDYTVTLVDRMPFHGLKPEFYALAAGTKSDKDVR
MKFPNHPQVNTVYGEINDIDLDAQIVSVGNSKIDYDELIIGLGCEDKYHNVPGAEEYTHS
IQTLSKARDTFHSISELPEGAKVGIVGAGLSGIELASELRESRSDLEIYLYDRGPRILRN
FPEKLSKYVAKWFAKNNVTVVPNSNINKVEPGKIYNCDEPKDIDLVVWTAGIQPVEVVRN
LPIDINSNGRVIVNQYHQVPTYRNVYVVGDCADLPHAPSAQLAEVQGDQIADVLKKQWLN
EPLPDKMPELKVQGIVGSLGDKQGFAYIMDRTVTGRLASILKSGVLWLYKYHNG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttagttttgttaggcggcggatatggtaatatgcgtatcatgtcacgcatt
ttaactacttctttaccacaagattatacagtcacattagttgatcgtatgccatttcat
ggattgaaaccagaattctatgctttagctgcgggcacgaaatcagataaagatgttcgc
atgaaattccctaatcatccacaagtgaatacagtttatggtgaaattaacgacatagat
ttagatgctcaaattgtctcagtcggtaattctaaaattgattatgatgagctaatcatt
ggtttaggatgtgaagataagtatcataacgttccaggagccgaagaatatacacatagt
attcaaacactctcaaaggctcgggatactttccatagtattagtgaactaccagaaggt
gctaaagttggtatcgttggtgctggattaagtggcatagaacttgccagcgaattaaga
gaaagtagatcagacttggaaatatatctttatgaccgtgggccgcgaattttaagaaat
tttccagaaaaattaagtaagtatgttgcgaaatggttcgccaaaaataatgttaccgtt
gttccaaattcaaatattaataaagttgaacctggtaaaatatataactgtgatgaacct
aaagatattgatttagttgtatggacagcaggaattcaacctgttgaagttgttcgtaac
ttgccgattgatataaatagtaatggacgcgtgatagttaaccagtatcatcaagtacca
acatatcgtaacgtctatgtagttggtgattgtgctgatttaccacatgcgccaagtgct
cagttagccgaagttcaaggtgatcaaattgccgatgtgcttaaaaagcaatggctaaat
gaaccattacctgacaaaatgccggaactaaaggtacaaggtatcgttgggtcattagga
gataaacaaggttttgcatatatcatggaccgcactgtaacaggacgactcgcttctatt
ttaaaatccggcgtactttggttatataaatatcataatggttaa

DBGET integrated database retrieval system