KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_2164Help
Entry
ST398NM01_2164    CDS       T02043                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00010  Glycolysis / Gluconeogenesis
sud00053  Ascorbate and aldarate metabolism
sud00071  Fatty acid degradation
sud00280  Valine, leucine and isoleucine degradation
sud00310  Lysine degradation
sud00330  Arginine and proline metabolism
sud00340  Histidine metabolism
sud00380  Tryptophan metabolism
sud00410  beta-Alanine metabolism
sud00561  Glycerolipid metabolism
sud00620  Pyruvate metabolism
sud00625  Chloroalkane and chloroalkene degradation
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST398NM01_2164
   00053 Ascorbate and aldarate metabolism
    ST398NM01_2164
   00620 Pyruvate metabolism
    ST398NM01_2164
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ST398NM01_2164
   00561 Glycerolipid metabolism
    ST398NM01_2164
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ST398NM01_2164
   00310 Lysine degradation
    ST398NM01_2164
   00330 Arginine and proline metabolism
    ST398NM01_2164
   00340 Histidine metabolism
    ST398NM01_2164
   00380 Tryptophan metabolism
    ST398NM01_2164
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ST398NM01_2164
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ST398NM01_2164
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ST398NM01_2164
Enzymes [BR:sud01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ST398NM01_2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4262
Motif
Other DBs
NCBI-ProteinID: AFH70352
UniProt: A0A0E0VQZ9
LinkDB All DBs
Structure
PDB: 

Position
complement(2083334..2084779)
Genome map
AA seq 481 aa AA seqDB search
MRSERIMRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNV
YLEFRHTSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAA
RDALDNYEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEE
TPFAAVILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEK
AAKDFKKVSLELGGKSPYIVLDDVDIKEVAKATTGKVVNNTGQVCTAGTRVLVPNKIKDA
FLAELKEQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEG
LEKGYFARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGK
DKETLHKVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYF
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgaggagtgaaagaataatgagagactacacaaagcaatatattaatggcgaatgggta
gaaagtaatagtaatgaaacgatagaagttataaatccagcaaccgaagaagtaatcggg
aaagttgctaaaggtaataaagctgatgttgataaagccgtcgaggcggcagacaatgtt
tatttagagttccgtcatacatctgtgaaagaaagacaagcattattagataaaattgta
aaagaatatgaaaacagaaaagacgatattgtacaagctattacggatgagttaggtgct
cctttatcattatctgagcgtgtccattatcaaatgggactaaaccattttgttgcagcg
agagacgcattagataactacgaatttgaagaacgccgcggagatgatttagttgttaaa
gaagcaatcggtgtatctggcttaattacaccgtggaacttccctacaaaccaaacatca
ttaaaattagcagcagcatttgcggctggtagtccagttgtacttaaaccatctgaagaa
acaccatttgcagctgttattttagctgagatttttgataaagtcggtgttcctaaaggt
gtatttaaccttgttaatggtgatggtgctggcgttggaaatcctttatctgaacatcct
aaagtacgcatgatgtcatttacaggatcaggccctactggttctaaaattatggaaaaa
gccgctaaagattttaaaaaggtatcattagagcttggtggcaaatcaccatacatcgtt
ctagatgacgtagatattaaagaagtggctaaagcaacaacaggcaaagttgttaataat
actggtcaagtatgtacagctggtacacgtgttttagtgcctaacaaaattaaagatgca
ttcttagctgaattaaaagaacaatttagccaagtgcgtgtcgggaatccaagagaagat
ggtacacaagtaggccctatcattagtaaaaaacaatttgatcaagtacaaaattatatt
aataaaggtattgaagagggtgctgaattattttatggtggtcctggtaaaccagaagga
cttgaaaaaggatactttgcacgtccgacaatttttattaatgtagataatcaaatgacg
atagcacaagaagaaatttttgggccagtaatgtcagttatcacttataacgatttagat
gaagcaattcaaattgcaaatgatacaaaatatggtttggcaggatatgttattggtaag
gacaaagaaacattgcataaagtagctcgttctattgaagcaggtacagtagaaataaac
gaagcaggtagaaagccagacttaccatttggtggctataaacaatctggtttaggtcgt
gaatggggcgattatggtattgaagagttcttagaagtgaaatctatagctggctatttt
aaataa

DBGET integrated database retrieval system