KEGG   Staphylococcus aureus subsp. aureus 71193 (MSSA): ST398NM01_2651Help
Entry
ST398NM01_2651    CDS       T02043                                 

Definition
(GenBank) Amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
sud  Staphylococcus aureus subsp. aureus 71193 (MSSA)
Brite
KEGG Orthology (KO) [BR:sud00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ST398NM01_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: AFH70870
UniProt: A0A0E0VS89
LinkDB All DBs
Position
2581855..2583318
Genome map
AA seq 487 aa AA seqDB search
MGGKFMGSFFNKIARKEDPAIYQNKDGHLKRTLRVRDFLALGVGTIVSTSIFTLPGIVAA
EHAGPAVALSFLLAAIVAGLVAFTYAEMAAAMPFAGSAYSWVNVLFGEFFGWVAGWALLA
EYFIAVAFVASGFSANLRGLVKPIGIELPAALSNPFGTNGGFIDIIAAIVILLTALLLSR
GMSEAARMENILVILKVLAIILFVIVGLTAINVSNYVPFIPEHKVTATGDFGGWQGIYAG
VSMIFLAYIGFDSIAANSAEALDPQKTMPRGILGSLSIAIVLFIAVALVLVGMFHYSQYA
NNAEPVGWALRQSGHGVVAAIVQAISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWLSH
LNDKHLPNRALVILTIIGVLIGSMFPFAFLAQLISAGTLVAFMFVSLAMYRLRKREGKDL
PIPAFKLPLYPVLPAVTFVLVLLVFWGLGFEAKLYTLIWFIVGIILYLSYGLRHSKKNNV
AEYHPPK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggaaagtttatgggaagttttttcaataaaatagcacgaaaagaagatccggct
atctatcaaaataaagatggtcatttaaagcgtacacttcgggtgcgtgatttcttagct
ttaggtgtaggaacaattgtatcgacatctatctttacgctacctggcattgttgctgca
gaacatgcaggaccggccgttgcgttatcattcttactcgctgctattgttgctggttta
gttgcatttacttatgcagaaatggctgccgctatgccatttgcaggttcagcctattct
tgggtcaatgtattatttggtgaattttttggatgggttgccggttgggctttattagct
gaatattttatcgccgtagcctttgttgcatcaggattctcagcgaatttacgcggactt
gtgaaaccaattggcatcgaattacctgcagcattatcaaatccatttggtacgaatggc
ggttttatcgatattattgctgctatcgttattttattaactgcattattactatcacgt
ggtatgtcagaagcagcacgtatggaaaatattttagttattttaaaagtattagctatt
attttatttgtaatcgtaggtttaacagcaataaatgttagtaactatgtgccatttatt
ccagaacacaaagtaactgctacaggtgactttggtggatggcaaggcatatatgctggt
gtttcaatgattttcttagcgtatatcggtttcgattctatcgcagcaaactcagcagaa
gcacttgaccctcaaaagacaatgcctagaggtattcttggttctttaagtattgctatc
gtattatttattgctgtagcacttgtgttagttggtatgttccattactcacaatacgca
aacaatgctgaacctgttggttgggctttacgtcaaagtggtcatggtgttgtagcagct
attgttcaagctatctctgttatcggtatgtttacagcattaattggtatgatgttagca
ggctcacgtttactttattcatttggacgtgacggcttattaccttcatggttaagccac
ttaaacgacaaacatttacctaatcgtgcactagttatacttactattattggtgtttta
attggttctatgttcccattcgcatttttagcacaattaatttcagccggtacacttgtt
gcatttatgttcgtttcattagcaatgtatcgtttgagaaagcgtgaaggtaaagattta
ccaattcctgcgtttaaattacctttatatcctgtgttaccagcagttacatttgtttta
gtattgctagtattctggggattaggattcgaagcgaaattatacactttaatttggttt
attgttggtatcattctatatttaagttatggacttagacattctaagaaaaataacgta
gctgaataccacccaccaaaataa

DBGET integrated database retrieval system