KEGG   Staphylococcus aureus subsp. aureus 71193 (MSSA): ST398NM01_2693Help
Entry
ST398NM01_2693    CDS       T02043                                 

Definition
(GenBank) hypothetical protein
  KO
K01421  putative membrane protein
Organism
sud  Staphylococcus aureus subsp. aureus 71193 (MSSA)
Brite
KEGG Orthology (KO) [BR:sud00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ST398NM01_2693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane DUF3533 ADIP Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AFH70917
UniProt: A0A0E0VSN3
LinkDB All DBs
Position
complement(2634186..2637173)
Genome map
AA seq 995 aa AA seqDB search
MTMKNAFKLFKMDLKKVAKTPAVWIILAGLAILPSFYAWFNLWAMWDPYGNTGHIKVAVV
NEDKGDTIRGKKVNVGNTMVNTLKKNKSFDWQFVSREKADHEIKMGKYFAGIYIPSKFTH
EITGTLRKQPQKADVEFKVNQKINAVASKLTDTGSSVVVEKANEQFNKTVTRALLEEANK
AGLTIEENVPTINKIKNAVYSADKALPKINDFANKIVYLNNHQADLDKYANDFRKLGNYK
GDILDAQKKLNEVNGAIPQLNEKAKLILALNNYMPKIEKALNFAADDVPAQFPKINQGLN
IASQGIDQANGQLNDAKGFVTQVRSRVGDYQDAIRRAQDLNRRNQQQIPQNSAANNETSN
SAPVAGNGVASTPPSAPNGNTAPNNNVTQNTAPNSNNAPVSTTPQSTSGKKDGQSFADIT
TTQVSTANENTQNITDKDVKSMEAALTGSLLSLSNNLDTQAKAAQKDSQALRNISYGILA
SDKPSDFRESLDNVKSGLEYTTQYNQQFIDTLKEIEKNENVDLSKEIDKVKAANNRINES
LRLVNQLSNALKNGSSGTAEATKLLDQLSKLDSSLSSFRDYVKKDLNSSLVSISQRIMDE
LNKGQTALSNVQSKLNTIDQVINSGQSILKNGKTRIDRLQTVLPSIEQQYISAVKNAQAN
FPKVKSDVAKAANFVRNDLPQLEQRLTNATASVNKNLPTLLNGYDQAVGLLNKNQPQAKK
ALSDLADFSQNKLPDVEKDLKKANKIFKKLDKDDAVDKLIDTLKNDLKKQAGIIANPINK
KTVDVFPVKDYGSGMTPFYTALSVWVGALLMVSLLTVDNKHKSLEPVLTTRQVFLGKAGF
FIMLGMLQALIVSVGDLLILKAGVESPVLFVLITIFCSIIFNSIVYTCVSLLGNPGKAIA
IVLLVLQIAGGGGTFPIQTTPQFFQNISPYLPFTYAIDSLRETVGGIVPEILITKLIILT
LFGIGFFVVGLILKPVTDPLMKRVSEKVDQSNVTE
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatgaagaacgcatttaaattatttaaaatggatctgaagaaagtagctaagacg
ccagctgtgtggattatcttagcaggcttagctattttgccatcgttctacgcttggttt
aacttatgggcaatgtgggatccatatggcaacacgggacacatcaaggtcgcagtcgtt
aatgaagataaaggcgacacaatcagagggaaaaaagttaatgtcggtaatacgatggtt
aatacactcaagaaaaataaaagttttgattggcagtttgtaagtagagagaaagctgat
catgagataaaaatgggtaaatattttgcaggtatttacatcccatctaagtttacacat
gaaattaccgggacactacgtaagcagcctcaaaaagcagatgtagaatttaaggtgaat
cagaagattaacgctgttgcgtctaagctaacagatactggttcgtcagttgtcgtcgaa
aaagcgaatgaacaatttaataaaacagtaactcgagcattattagaagaagctaacaaa
gcaggtttaactattgaagaaaatgtgccgacaattaataagataaaaaatgcggtatat
tcagcagataaagctttacctaagattaatgactttgcgaataaaattgtatatttgaat
aaccaccaagcggatttagataaatatgcgaatgattttagaaaactaggaaattataaa
ggtgatattttagatgctcagaaaaaattaaacgaagtcaatggtgctattccgcaactt
aatgaaaaggctaagttgatcttagctttaaataattatatgccgaaaattgaaaaagcg
ttaaattttgcagctgatgacgtgccagcgcagttccctaaaattaatcaaggacttaac
attgcgagtcaaggtattgatcaagctaatggacagttaaatgatgccaaaggcttcgtc
acacaagttagaagtagagtcggtgattatcaagatgcaattcgacgcgcgcaagattta
aatcgaagaaaccagcaacagattcctcaaaatagcgcggcgaacaacgaaacatcaaat
agtgcacctgtagctggtaatggtgtagcatcaacgccaccaagtgcaccaaatggcaat
actgcaccaaataataatgttacgcaaaataccgcaccaaatagtaataatgcgcctgta
tcgactacaccacaaagtacaagcgggaaaaaagatggacaaagttttgcggatataaca
acaacacaagtcagcacagcaaacgagaacacacaaaacattacagataaagatgttaaa
tcaatggaagcggcattaacgggctctttattatcattatcaaataatttagatacccaa
gcgaaagccgcacaaaaagatagtcaggcattacgtaatatttcgtatggcattttagca
tcggacaagccttctgattttagagagtctttagataatgttaagtccggtttagaatac
acaactcaatacaatcaacaatttatcgatacattaaaagagattgagaagaatgaaaat
gttgatttatcaaaagaaattgataaggtaaaggcagctaataatcgaattaatgaatca
ttaaggttagttaatcaattaagcaatgcattaaagaatggtagttcaggaactgctgaa
gctactaaattactagatcaactgtcaaaactagattcatcattatcatcatttagagat
tatgttaaaaaagatcttaacagctctttagtatcaatatcacaacgtattatggatgaa
ttgaataaagggcaaacggcattgtctaatgttcagtctaagctaaatacaattgatcaa
gtcatcaacagtggtcaatctattttaaaaaatggtaaaacacgtatcgatcgtttacaa
acagtattaccaagtattgaacaacaatacattagtgctgttaaaaatgctcaagcaaac
ttccctaaagtgaaaagtgatgtagcgaaagcagctaactttgtacgtaacgatttacca
cagttggagcaacgtttaaccaatgcgactgcaagtgtaaataaaaatttaccaacgtta
ttaaatggttatgatcaagcggtaggattactaaataaaaatcagccacaagcgaaaaag
gctttatcagatttagctgatttttctcaaaataaattgccagatgttgaaaaagatctg
aaaaaagcgaataagattttcaagaagttagacaaagacgatgcagtcgataaattaatc
gacacacttaagaatgatttgaaaaagcaagcgggtattattgcaaatcctattaataag
aagactgttgatgttttcccagttaaggattatggatcagggatgacaccattctatact
gcattatcggtatgggtaggcgcactcttaatggtaagcctattaactgttgataataaa
cataagagcttagagccagtgttaacgacaagacaagttttcttaggtaaggcaggattc
tttataatgcttggtatgttgcaagcactcattgtatcggttggagatttgttaatccta
aaagcaggagttgagtcacctgtattattcgtacttataacgattttctgttcgattatt
ttcaactcaatcgtatatacgtgcgtatcattacttggtaacccaggtaaagccattgca
atcgtattgcttgtattacaaattgcaggtggtggaggaacattcccaattcaaactacg
ccacaatttttccaaaacatttcaccatacttaccatttacgtatgccattgattcatta
cgtgaaacagtaggcggtattgttccggaaatcttaattacaaaattaattatattaacg
ttatttggcataggattcttcgttgtaggtttaattttaaaacctgtaacagatccattg
atgaagcgcgtatctgaaaaagttgaccaaagtaacgttacagaataa

DBGET integrated database retrieval system