KEGG   Staphylococcus aureus subsp. aureus 71193 (MSSA): ST398NM01_2704Help
Entry
ST398NM01_2704    CDS       T02043                                 

Definition
(GenBank) Serine-rich adhesin for platelets
Organism
sud  Staphylococcus aureus subsp. aureus 71193 (MSSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bact_lectin Gram_pos_anchor HYR
Motif
Other DBs
NCBI-ProteinID: AFH70928
UniProt: A0A0E0VUM6
LinkDB All DBs
Structure
PDB: 

Position
complement(2653025..2659864)
Genome map
AA seq 2279 aa AA seqDB search
MSKRQKEFHDSLANEKTRVRLYKSGKNWVKSGIKEIEMFKIMGLPFISHSIVSQDNQSIS
KKMTGYGLKTTAVIGGAFTINMLHDQQAFAASDAPLTSELNTQSETVGNQNSTTIEASTS
TADSTSVTKNSSSVQTSNSDTVSSEKSENVTSTTNSTSNQQEKLTSTSESTSSKNTTSSS
DTKSVASTSSTEQRTNISTNQSTASNTTSQSTAPAPTHLKQTSTTSTSTAPVKLRTFSRL
AMSTFASTATTSAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITL
GTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAF
GFKLDTYHNTSTPNVSAKAKADPPSVAGGGAFGAFVTTDSTGVASTYTSSSIADNAAKLN
IQPTNNAFQDFDINYNGDTKVMTVTYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATN
LQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNY
TSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTT
DNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQTNNKSTTTFTINVV
DTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTP
TNIGTSTITIVSTDASGNKTTTTFKYEVTRNSMSDSVSTSGSTQQSQSVSTSKADSQSAS
TSTSGSIVVSTSASTSKSTSVSLSDSVSASKSLSTSESNSVSSSTSTSLVNSQSVSSSMS
GSVSKSTSLSDSISNSSSTEKSESQSTSTSDSLRTSTSLSDSVSMSTSGSLSKSQSLSTS
TSDSASTSQSVSDSTSNSISTSESLSESASTSDSISISNSIANSQSASTSKSDSQSTSIS
LSTSDSKSMSTSESLSDSTSTSGSVSGSLSIATSQSVSTSTSDSMSTSEIVSDSISTSGS
LAASDSKSMSVSSSMSTSQSGSTSESLSDSISTSDSDSKSLSLSTSQSGSTSTSTSTSSS
VRMSESQSTSGSMSTSQSDSTSISTSFSDSTSDSKSASTASSESISQSVSTSTSGSVSTS
TSLSTSNSERTSTSMSDSTSLSTSESDSTSDSTSTSDSISEAISGSESTSISLSESNSTS
DSESKSASAFLSESLSESTSESTSESLSSSTSASTSLSDSNSESGSTSTSLSNSTSSSTS
ISTSTSGSASTSAYKSESVSTSLSTSTSTSLSDSTSLSTSLSDSASGSKSNSLSASMSTS
DSISTRKSESLSTSTSLSGSTSESESGSTSSSESKSDSTSMSLSMSQSTSGSTSVSTSES
LSDSTSTSLSLSASMNQSGIDSNSASQSVSASTSTSTSESDSQSTSSYTSQSTSQSESTS
TSMSLSDSTSMSRSTSQSGSTSTSASLSGSESESDSQSISTSASESTSESTSTSLSDSES
TSNSTSESTSNAISTSASASESDSSSTSLSDSTSASMQSSESDSQSTSTSLSNSQSTSTS
NRMSTITSESVSESTSESGSTSESTSESDSTSTSLSDSQSTSRSTSASGSASTSTSTSDS
RSTSASTSTSMRTSTLDSQSMSLSTSTSTSVSDSTSLSDSVSDSTSDSTSTSTSGSMSAS
ISLSDSTSTSTSASEVMSVSISDSQSMSESVNYSESVSESNSESDSKSMSGSTSVSDSGS
LSVSTSLRKSESVSESSSLSGSQSMSDSVSTSDSSSLSVSTSLRSSESVSESDSLSDSKS
TSGSTSTSTSGSLSTSTSLSGSESVSESSSLSDSISMSDSTSTSESDSLSGSISLSGSTS
LSTSDSLSDSKSLSSSQSMSGSESTSTSVSDSQSSSTSNSQFDSMSISASESDSVSTSDS
SSISGSNSTSTSLSTSDSMSGSVSVSTSTSLSDSISGSISVSDSSSTSTSESLSDSMAQS
QSTSTSASGSLSTSISTSMSMSASTSTSQSTSVSTSLSTSDSISDSTSISISGSQSAVES
ESTSDSTSISDSESLSTSDSDSTSTSTSDSTSGSTSTSTSESLSMSGSDSTSVSDSTSMS
ESDSTSVSMSLSTSDSTSISDSESVSTSTSMSLSTSESLSTSMSGSQSISDSTSTSMSNS
TSMSNSTSTSMSGSTSTSESNSMHPSDSMSMHHTHSTSTSRSSSEATTSTSESQSTLSAT
SEVTKHNGTPAQSEKRLPDTGDSIKQNGLLGGVMTLLVGLGLMKRKKKKDENDQDDSQA
NT seq 6840 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagacagaaagaatttcatgacagcttagcaaacgaaaaaacaagagtaaga
ctttataaatctggaaaaaattgggtgaaatccggtattaaagaaatagaaatgttcaaa
ataatgggactaccatttattagtcatagtatagtgagtcaagataatcaaagcattagt
aaaaaaatgactggatacggactgaaaacgacggcagtgatcggcggggcatttacaata
aatatgttacatgatcagcaagcttttgcggcttctgatgcacctttaacatctgaatta
aacacgcaaagtgaaaccgtaggcaatcaaaactcaacgacaatcgaagcatcaacatca
acagccgattccacaagcgtaacgaaaaatagtagttcggtacaaacatcaaatagtgac
acagtctcaagtgaaaagtctgaaaatgtcacttcgacaactaatagtacaagcaatcaa
caagaaaaattaacatctacatcagaatcaacatcctcaaagaatactacatcaagttct
gatactaaatctgtagcttcaacttcaagtacagaacaacgaactaatatatcaacaaat
caaagcactgcatcaaatactacttcacaaagcacagcgccagctccaacccatttaaaa
caaactagcacaacgtcaaccagcacagcacctgtcaaacttcgaactttcagtcgatta
gctatgtcaacttttgcatcaactgcaacgacaagtgcagtaaccgctaatacgattacg
gttaataaagataacctcaaacaatatatgacaacgtcaggtaatgctacttatgatcaa
agtaccggtattgtgacgttaacgcaggatgcatacagccaaaaaggtgctattacatta
ggaacacgtattgactctaataaaagttttcatttttctggaaaagtaaatttaggtaac
aaatatgaagggcatggaaatggtggagatggtataggttttgccttttcacctggtgta
ttgggagaaacagggttaaacggtgccgcagtaggtatcggtggcttaagtaacgcattt
ggcttcaaattggatacgtatcacaatacatctacaccgaatgtatcagcaaaggcgaaa
gctgacccacctagtgttgctggtggaggtgcgttcggtgcctttgtaacaacagatagt
actggtgttgcatcaacatatacatcaagttcaatagctgataatgctgcaaagttaaat
attcaaccaacaaataacgcatttcaagattttgatattaattataatggtgatacaaaa
gttatgactgtcacgtatgcaggtcaaacatggacacgtaatatttcagattggattgca
aaaagtggtacgaccaacttttcattatcaatgacagcctcaacaggtggcgcgacaaat
ttacaacaagtacaatttggaacattcgaatatacagagtctgctgttacacaagtgaga
tacgttgatgtaacaacaggtaaagatattattccaccaaaaacatattcaggaaatgtt
gatcaagtcgtgacaatcgataatcaacaatctgcattgactgctaaaggatataattac
acatctgtcgatagttcatatgcatcaacttataatgatacaaataaaactgtaaaaatg
acgaatgctggacaatcagtgacatattattttactgatgtaaaagcaccaactgtaact
gtaggcaatcaaaccattgaagtgggtaaaacaatgaatcctatagtgttgactacaacg
gataatggtactgggactgtgacaaatacagttacaggattgccaagcggattaagttat
gatagtgcaacgaattcaatcattgggacaccaacaaaaattggtcaatcaacagtgaca
gtagtatctactgaccaaacaaataacaaatcgacgacaacttttacaataaatgttgtg
gatacgacagcaccaacagtgacaccaataggagatcaatcatcagaagtgtattcacca
atatccccgattaaaattgctacgcaagataatagtgggaatgcagtaacaaatacagtc
acaggattgccgtctggattaacattcgatagcacaaataatactattagtggtacacca
acaaacattggtacaagtactataacaatcgtttctacagatgcgagcggtaacaaaacg
acgacaacttttaaatatgaagtaacaagaaatagcatgagtgattccgtatcaacatca
ggaagtacacaacaatcccaaagtgtgtcaacaagtaaagctgactcacaaagtgcatca
acgagcacatcaggatcgattgtggtatctacatcagctagtacctcgaaatcgacaagt
gtaagcctatctgattctgtgagtgcatctaagtcattaagcacatctgaaagtaatagt
gtatcaagctcaacaagcacaagtttagtgaattcacaaagtgtatcatcaagcatgtca
ggttcagttagtaaatcaacatcattaagcgattctatttcgaactctagcagtactgaa
aaatccgaaagtcaatcaacaagcacatctgattcattgcgcacatcaacatcgttaagt
gattcagtaagcatgagtacatcaggaagcttgtctaagtcacaaagcttatcaacaagt
acatctgattcggctagtacatcacaatcggtaagtgatagtacatcaaattcaattagt
acatcagaatcattgagcgagtcagctagcacctcggactctatcagtatttcaaatagc
atagccaactctcaaagtgcgtcaacaagcaaatcagattcacaaagtacatcaatatca
ttaagtacaagtgattcaaaatcgatgagtacatcagaatcattgagcgattcgacgagc
acaagtggttctgtttctggatcactaagcatagcaacatcacaaagtgtctcaacaagt
acatcagactcaatgagcacttcagagatagtcagtgactctatcagtacaagtgggtca
ttagctgcatcagacagtaaatcaatgtctgtaagtagttcaatgagcacgtctcagtca
ggtagtacatcagaatcattaagtgattcgataagtacctcggattctgacagtaagtca
ttatcattgagtacaagtcagtctggctcaacaagcacatcaacatcaacaagtagttca
gtacgtatgtcggaatcacaaagtacgtctggttcaatgagcacaagtcaatccgattca
acgagcatatcaacgtcgtttagtgattcaacaagtgatagcaaatcagcatcaactgca
tcgagtgaatcaatatcacaaagtgtctcaacaagtacatctggttcagtgagtacttcg
acatcgttaagtacaagtaattcagagcgtacatcaacatctatgagtgattccacaagc
ttaagtacatcagagtctgattcaacgagcgactcaacgtcgacgagcgattctatcagt
gaagcgatatctggatcagagagtacgtctatatcattaagtgaatcaaatagtacaagt
gattcagagtcgaaaagtgcatctgcttttttaagtgaatcattgagtgaaagcacatcc
gaatcaacatcagagtcattaagcagttcgacaagtgcgagtacgtcattatcagacagt
aattctgaatctggtagcacatcaacatcattaagcaattcaacaagtagcagtacatct
atttcaacgtcaacaagtggtagcgcatcaacatcagcgtataagagcgagagtgtctca
acatcattgagcacatcaacgagtacaagtttgtctgactctacaagtttgtcaacatca
ttaagtgattcagcaagtggtagcaagtccaattcactaagtgcatcaatgtcgacaagt
gattcaatcagtacaagaaaatcagagtcattaagtacatcgacatcattaagcggttca
acgagtgagagtgaatccggctcaacatcatcaagtgaaagtaaatccgattcaacatca
atgagcctgagcatgtcccaatcaacatcaggaagtacaagtgtgtcaacatcagaaagt
ttgtctgactcaacgagtacatcattgtcactgagtgcctcaatgaatcaaagtggtata
gactcaaactcagcaagccaaagtgtctcagcatcaacaagtacaagcacgagcgaatcc
gattcacaaagcacatcatcatatacaagtcagtcaacaagccaaagtgaatcaacatca
acatcaatgtcactaagcgattcaacaagtatgtctagaagtacgagccaatcaggttca
acaagcacatcagcatcattaagtggttcagagagtgaatctgattcacaaagtatatca
acaagtgcaagtgaatcaacatcagaaagtacatcaacatcgctcagtgactcagaaagt
acaagcaactcaacatcagaaagcacatcgaatgcaattagtacgtcagcaagcgcaagt
gaatccgattcgtcgtcaacatcattaagtgattcaacgtcagcgtcaatgcaaagcagt
gaatccgattcacaaagcacatcaacatcattaagtaattcacaaagcacatcaacatca
aaccgaatgtcgactattacaagtgagtcagtatcggaaagtacatcagaatctggctca
acatcagaaagtacaagtgaatccgattcaacatcaacatcattaagcgattcacaaagc
acatcaagaagtacaagtgcatctggatcggcaagtacatcaacatcaacaagtgactct
cgtagtacatcagcttcaactagtacttcgatgcgtacaagtacgctggattcacaaagt
atgtcgctttcaacaagtacatcaacaagtgtgagtgattcaacgtcattatctgatagt
gtgagtgattcaacatcagactcaacaagtacgagtacatctggttcgatgagtgcgtct
atatcgttaagtgattcgacaagcacatcaacatcggctagtgaagtaatgagcgtaagc
atatctgattcacaaagtatgtcagaatctgtaaattattcagaaagtgtaagtgaatct
aattctgaaagtgactcaaaatcgatgagtggttcaaccagcgtcagtgattctggctca
ttgagcgtctcaacgtcattaagaaaatcagaaagtgtaagcgagtctagttcattgagt
ggctcacaatcgatgagtgattcagtaagcacaagcgattcgtcatcattaagtgtatcg
acgtcactaagaagttcggaaagcgtgagtgaatctgattcattaagtgattcaaaatcg
acaagtggttcgacttcaacaagtacatctggttcattgagcacttcgacatcattaagt
ggttcagaaagtgtaagcgagtctagctcgctaagtgattcaatatcaatgagtgattct
actagtacaagtgaatccgactcattaagtggatcaatatctttaagtggttccacaagt
cttagcacttcggattcattaagtgattcaaaatcattaagtagctcgcaaagtatgagt
ggatcagaatcaacgtcaacaagcgtgagtgattctcagtcaagctcaactagtaatagt
caatttgactctatgagcatcagtgcatctgaaagtgactcagtgtctacaagtgattca
tctagcatcagtggatcaaattcaacgagtacatcactttcaacatctgattcaatgagc
ggaagcgtatcagtttcaacatcgacaagtttaagtgactcaatatcaggttcaataagt
gtaagtgactcgagctcaacgagtacatcagagtcgctaagtgattctatggcacaaagc
cagtcaacaagtacaagtgcatctggttccttaagtacatcgatatcaacatcaatgtca
atgagtgcaagtacatcgacatcacaaagcacgtcggtgtcgacatcattatcaacatca
gacagtatcagtgattccacttcaataagtatcagtggttcacaaagtgctgtagaatca
gaatctacaagtgattcaacttctatcagtgactcagaatcattaagtacatcagattca
gactcaacatcaacaagtacatcggactcaacaagtggttcaacttcaacaagcacatct
gaatcgctaagtatgtctggttcagattcaacgagcgtatctgactcaacatcaatgagt
gaatccgattcaacaagtgtttcaatgtcattgagcacatccgattcaacatcaattagc
gactcagaatcagtgtcaacaagcacatcaatgtcattgagcacatccgaatcgctgagt
acatctatgtctggttcacaaagcatttctgactcaacatcaacaagtatgtctaactcg
acttcaatgagcaactcaacatcaacaagtatgtccggctcaacaagtacatctgaatct
aactcaatgcatccgtcagactcaatgagtatgcatcatacacacagcacgagcacatct
cgctcatcaagtgaagcaacaacgagcacgagtgaatctcagtctacattaagtgcaaca
tctgaagtgactaaacataatggcacgccagcacaaagtgaaaaaagattgccagataca
ggtgactcaataaaacaaaatggattactaggtggcgttatgacattattagttggttta
ggtttaatgaagagaaagaaaaagaaagatgaaaatgatcaagatgattctcaagcataa

DBGET integrated database retrieval system