KEGG   Staphylococcus aureus subsp. aureus LGA251 (MRSA): SARLGA251_06530Help
Entry
SARLGA251_06530   CDS       T02085                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
suf  Staphylococcus aureus subsp. aureus LGA251 (MRSA)
Brite
KEGG Orthology (KO) [BR:suf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:suf02000]
    SARLGA251_06530
Transporters [BR:suf02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    SARLGA251_06530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_tran_Xtn ABC_tran_CTD SMC_N MMR_HSR1 RsgA_GTPase AAA_29 AAA_18 AAA_16 AAA_15 AAA_30 cobW AAA_22 AAA_24 MeaB Dynamin_N Bacillus_HBL AAA_28 T2SSE Arf NB-ARC Roc FeoB_N NACHT
Motif
Other DBs
NCBI-ProteinID: CCC87421
LinkDB All DBs
Position
748819..750696
Genome map
AA seq 625 aa AA seqDB search
MEAYKIEHLNKSYADKTIFDNLDLSISEGEKIGLVGINGTGKSTLLKVIGGIDDDFSANV
MHPNQYRIRYSSQKQDLNEDMTVFDAVLSSDTTTLRIIKQYEQAVQAYADDQSDKLFKRM
MDAQDAMDQHDAWDYNAEIKTILSKLGIHDTTKYIKELSGGQQKRVVLAKTLIEQPDLLL
LDEPTNHLDFESISWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELNRGKLASYPGNYE
SYIEMRAEREVTLQKQQQKQRALYKEELAWMRAGAKARTTKQQARINRFNDLENEVNQQY
KDDKGELNLAYSRLGKQVFELEDLSKAINDKVLFEHLTEIIQKGERIGVVGPNGAGKTTL
LNILSGEDQQFEGKLKTGQTVKVAYFKQTDETLDRDIRMIDYLREESEIAKEKDGTSVSI
TQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHQPNVLLLDEPTNDLDTETLTILE
DYIHTFGGTVITVSHDRYFLNKVAQSYWFIHDGQMEKIIGTFEDYESYKKSLDKNKSTLK
QQSKSSTTVRKKNGLSYKEKLEYEQLMKRIEQAEVRMEEIDVLMIEASADYGKIKELNEE
KEQLEIQYDLDITRWSELEEIKEQQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggaagcatataaaattgaacatttaaataaatcttatgccgataagactatattcgat
aacctagatttatcaatttcagaaggtgaaaaaataggtttggtaggcataaatggtaca
gggaaaagtacgttgttaaaagtaattggtggtattgatgatgatttttcagccaatgtt
atgcatccaaatcaatatcgaattcgatattcgtctcagaaacaggaccttaatgaagat
atgacagttttcgatgcagtattaagttctgatacaacaactttacgtatcatcaagcaa
tatgagcaggcagtacaagcttatgcggatgaccaaagtgataaattgttcaagcgaatg
atggatgcgcaagatgctatggatcaacatgatgcttgggactataacgctgaaattaaa
acaattctctcaaaactaggtatacatgataccactaaatacattaaagaattatccggc
ggacaacaaaaacgtgttgtacttgctaaaacattaatagaacaaccagatttattgtta
ttagatgaacctacgaaccatttagacttcgaatcaatcagctggttgatcaactatgtg
aagcaatatcctcatacagttttattcgtaacccatgatcgatattttttaaatgaagtt
tccactagaattattgaactaaacagaggtaagttagcgtcatatcctggtaactatgaa
tcttatattgaaatgcgcgctgaaagagaagtaacacttcaaaagcaacaacaaaaacaa
cgagctttatataaggaagaacttgcttggatgagggctggagctaaggctcgtactaca
aagcaacaagctagaattaatcgatttaatgacctagaaaatgaagttaaccagcaatat
aaagacgataaaggtgaattgaatcttgcttattcaagattaggtaagcaagtgtttgaa
ttagaagacttatcaaaggctattaatgataaagtattatttgaacatctgacggaaatt
attcaaaaaggtgagcgtattggtgttgttgggccaaatggagctggtaaaacaacactc
ttaaatattttgagtggagaagaccaacaattcgaaggtaaattgaagactgggcagacg
gttaaagtagcttattttaagcaaacagatgagaccctggatagagatattcgtatgatt
gattatttaagagaagaaagtgagatcgcaaaagaaaaagatggaacctcggtatctatt
acacaacttcttgaacgatttttatttccaagtgccactcatggtaaaaaagtttataaa
ttatctggtggagagcaaaagcgtttgtatttactacgtttactcgtacaccagccaaat
gttctgttgttagatgaaccgacaaatgatttagatactgagactttaacaatacttgaa
gattatattcatactttcggtggtacagtgattaccgtaagccatgatcgttacttctta
aataaagttgcacagtcatattggtttattcatgatggtcagatggaaaagattatagga
acttttgaagattatgaaagttataaaaaatcattagataaaaataaatccacattgaag
caacaatctaaatcttctacaactgtacgtaagaaaaatgggttatcatataaagaaaaa
ttagaatatgaacaattgatgaaacgcatagaacaagcggaagtaagaatggaagaaatt
gatgtgctcatgattgaggcaagtgcagattatgggaaaattaaagaattaaacgaagaa
aaagaacaacttgaaattcaatatgatttagacatcacaagatggagtgagttagaagaa
attaaagaacaacaataa

DBGET integrated database retrieval system