KEGG   Staphylococcus aureus subsp. aureus LGA251 (MRSA): SARLGA251_10610Help
Entry
SARLGA251_10610   CDS       T02085                                 

Gene name
sdhB
Definition
(GenBank) putative succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251 (MRSA)
Pathway
suf00020  Citrate cycle (TCA cycle)
suf00190  Oxidative phosphorylation
suf00650  Butanoate metabolism
suf01100  Metabolic pathways
suf01110  Biosynthesis of secondary metabolites
suf01120  Microbial metabolism in diverse environments
suf01130  Biosynthesis of antibiotics
suf01200  Carbon metabolism
Module
suf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SARLGA251_10610 (sdhB)
   00650 Butanoate metabolism
    SARLGA251_10610 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SARLGA251_10610 (sdhB)
Enzymes [BR:suf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SARLGA251_10610 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SARLGA251_10610 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CCC87829
LinkDB All DBs
Position
1160319..1161134
Genome map
AA seq 271 aa AA seqDB search
MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaatcagtgaaaaacactccacaacatgaaacacaatctaaaccgaaacaa
aaaacagtaaaattaattattaaacgacaagatacaagtgattctaagccttatgaagaa
acatttgaaattccatatcgtgaaaatttaaacgtcattgcttgtttaatggaaattaga
cgtaacccagttaatattaaaggtgaaaaaacaacacctgttgtctgggatatgaactgc
ttagaagaagtatgtggagcatgttctatggttatcaatggtcgtgcaagacaatcttgt
tctgcgattgttgatcaattagaacaacctattcgtttagagccaatgaatactttccca
gttatccgtgacttacaagttgatcgttctagaatgttcgataacttaaaacgtatgaaa
gcatggatcccaatcgatggaacgtatgatttaggtccgggaccacgtatgccagagaaa
aaacgtcaaacagcttatgaattatctaaatgtatgacatgtggtgtatgtttagaagtt
tgtcctaatgttactgaaaataataaatttgttggtgcgcaagcaatctcgcaagttcgt
ttgtttaatttgcacccaacaggatctatgactaaggatgaacgtttaaatgcattaatg
ggtacaggtggcttacagcaatgtggtaattcacaaaactgtgttaatgcttgccctaaa
ggtattccattaacaacatccattgcagcaatgaacagagaaacaacattccacatgttt
aaatcattctttggttcagaccatgaagtagaataa

DBGET integrated database retrieval system