KEGG   Staphylococcus aureus subsp. aureus LGA251 (MRSA): SARLGA251_12110Help
Entry
SARLGA251_12110   CDS       T02085                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251 (MRSA)
Pathway
suf00564  Glycerophospholipid metabolism
suf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SARLGA251_12110 (glpD)
Enzymes [BR:suf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SARLGA251_12110 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 Pyr_redox Lycopene_cycl NAD_binding_8 FAD_oxidored GIDA 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: CCC87979
LinkDB All DBs
Position
1327734..1329407
Genome map
AA seq 557 aa AA seqDB search
MALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMKVALVEMQDFAQGTSSR
STKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTSI
GLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYVEYRTDDARLTIEVMKR
AAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAKKVVNAAGPWVDDVRSG
DYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAIPREGKAYVGTTDTFYD
NIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPLIYEEGKDPSEISRKDE
IWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSPCNTKGLAISGGDVGGS
KNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQTSQYHDSKLPLEIYVEL
VYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDSIIDIMADMLDYSPAQIEAYTEEVE
QAIKEAQHGNNQPAVKE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtctacttttaagagagaacatattaaaaagaatttaagaaatgatgaatat
gatttagtaattattggtggcggtattacaggtgcaggtattgcactagacgcgagtgaa
agaggaatgaaagttgcattggttgaaatgcaagactttgcacaaggaacaagctcaaga
tctacaaaattagtccatggtggtttacgttacttaaaacaattccaaattggagtagtt
gccgaaactggtaaagaacgtgcgattgtttatgaaaatgggcctcatgttacgactcca
gagtggatgcttttaccaatgcataaaggtggaacatttggtaaattctcaacatcaatt
ggtttaggaatgtatgatcgtttagcaggtgttaagaagtctgaacgtaaaaaaatgtta
tctaaaaaagaaactttagctaaagaaccattagttaaaaaagaaggtctaaaaggcggc
ggttactatgttgaatatcgtactgacgatgcgcgtttaactattgaagttatgaagcgt
gctgctgaaaaaggcgcagaaattatcaactatactaagtcagaacacttcacttatgat
aaaaatcaacaagtaaatggtgttaaagttattgataaattaactaatgaaaattataca
attaaggctaaaaaagtggttaatgcagcaggtccttgggttgatgatgttagaagtggt
gattatgcacgcaataataaaaaattacgtttaactaaaggtgtacatgttgttattgat
caatcaaaattcccattaggtcaagcagtatactttgatactgaaaaagatggaagaatg
atttttgcaatcccgcgtgaaggaaaagcgtatgtaggtactacagatacattctatgac
aatatcaaatcttcaccattaactacacaagaagacagagactatttaatcgatgcgatt
aattacatgttccctagtgttaatgttacagatgaagatattgaatcaacatgggcagga
attagaccattaatttacgaagaaggcaaagacccttctgaaatctctcgtaaggatgaa
atttgggaaggtaaatcaggtttattaactattgcaggtggtaaattaacaggctatcgt
cacatggctcaagacattgttgatttagtatctaaacgcttgaaaaaagactacggttta
acatttagtccatgtaatacaaaaggtctggcaatttcaggtggcgatgtaggaggtagc
aagaactttgatgcgtttgtagagcaaaaagtagatgtagctaaaggattcggcattgat
gaagatgttgcaagacgtttagcatctaaatatggttcaaatgttgatgaattgttcaat
attgcgcaaacatctcaataccatgatagcaagttaccattagaaatttatgtagaactt
gtttatagtattcaacaagaaatggtatacaaacctaacgatttcttagttcgtcgttct
ggtaaaatgtacttcaatattaaagatgtattagattataaagatagtatcatcgatatt
atggctgatatgttagactactcaccagctcaaattgaggcttatactgaagaagttgag
caagcaattaaagaagcgcaacatggaaataatcaaccagcagttaaagaataa

DBGET integrated database retrieval system