KEGG   Staphylococcus aureus subsp. aureus LGA251: SARLGA251_19230Help
Entry
SARLGA251_19230   CDS       T02085                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251
Pathway
suf00010  Glycolysis / Gluconeogenesis
suf00053  Ascorbate and aldarate metabolism
suf00071  Fatty acid degradation
suf00280  Valine, leucine and isoleucine degradation
suf00310  Lysine degradation
suf00330  Arginine and proline metabolism
suf00340  Histidine metabolism
suf00380  Tryptophan metabolism
suf00410  beta-Alanine metabolism
suf00561  Glycerolipid metabolism
suf00620  Pyruvate metabolism
suf00625  Chloroalkane and chloroalkene degradation
suf01100  Metabolic pathways
suf01110  Biosynthesis of secondary metabolites
suf01120  Microbial metabolism in diverse environments
suf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARLGA251_19230
   00053 Ascorbate and aldarate metabolism
    SARLGA251_19230
   00620 Pyruvate metabolism
    SARLGA251_19230
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SARLGA251_19230
   00561 Glycerolipid metabolism
    SARLGA251_19230
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SARLGA251_19230
   00310 Lysine degradation
    SARLGA251_19230
   00330 Arginine and proline metabolism
    SARLGA251_19230
   00340 Histidine metabolism
    SARLGA251_19230
   00380 Tryptophan metabolism
    SARLGA251_19230
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SARLGA251_19230
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SARLGA251_19230
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SARLGA251_19230
Enzymes [BR:suf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SARLGA251_19230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCC88688
LinkDB All DBs
Structure
PDB: 

Position
complement(2134139..2135566)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDEVGVPKGVFNLVNGDGADVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAREEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacaatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcattattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcgatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgatgaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctgacgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagctgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacgagaagaaatt
tttgggccagtaatgtcggttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system