KEGG   Staphylococcus aureus subsp. aureus LGA251 (MRSA): SARLGA251_21940Help
Entry
SARLGA251_21940   CDS       T02085                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K10010  L-cystine transport system ATP-binding protein [EC:7.4.2.1]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251 (MRSA)
Pathway
suf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:suf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SARLGA251_21940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:suf02000]
    SARLGA251_21940
Enzymes [BR:suf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     SARLGA251_21940
Transporters [BR:suf02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    SARLGA251_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_15 AAA_16 AAA_22 AAA_29 AAA_14 AAA_24 PduV-EutP ATPase_2 AAA_5 NB-ARC RsgA_GTPase AAA_30 AAA_23 G-alpha NACHT TsaE cobW AAA_19 MobB PRK AAA_25 AAA AAA_33 AAA_28
Motif
Other DBs
NCBI-ProteinID: CCC88958
LinkDB All DBs
Position
complement(2418735..2419466)
Genome map
AA seq 243 aa AA seqDB search
MIQLNNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
NEE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattgaacaatatccataaatcatttaatgatgttgaagtcatcaaaggtatt
gatttatctgttgaacaaggtgaggttgtaaccttaatcggtcgatctggttcaggtaaa
acaacattgttacgtatgattaatgcattagaaattccaactgaaggtacagtttatgtt
aacggcaaaacatatacatctaaagataaaaaatcacaaatagaagttcgtaaacagtct
ggtatggtatttcaaagttataacctttttccgcataagacggcattagaaaatgtaatg
gaaggtcttatcacagttaaaaagttgaaaaaggatgaggcacgtgggaaatcacttgag
ttacttgagaaagttggtttaacacatgtcaaagatcaacgtccacatgcattatcaggt
ggtcaacaacaacgtgttgctattgcaagagcactagcaatgaaccctaaagtgatgttg
tttgatgaaccaacatctgcacttgatcctgaacttgtgaatgatgttttaaaggttatt
aaagatttggctaatgaaggcatgacaatggtcattgtgacacatgaaatgcgttttgct
aaagaagtatctaataacattgtatttattcatgaaggcatgatcggagaacaaggggct
ccagaagagatgttcaatcgtccgaaaacagaagaattaagacgtttcttaaatgttata
aatgaagaataa

DBGET integrated database retrieval system