KEGG   Staphylococcus aureus subsp. aureus LGA251: SARLGA251_21980Help
Entry
SARLGA251_21980   CDS       T02085                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251
Pathway
suf00010  Glycolysis / Gluconeogenesis
suf00260  Glycine, serine and threonine metabolism
suf00680  Methane metabolism
suf01100  Metabolic pathways
suf01110  Biosynthesis of secondary metabolites
suf01120  Microbial metabolism in diverse environments
suf01130  Biosynthesis of antibiotics
suf01200  Carbon metabolism
suf01230  Biosynthesis of amino acids
Module
suf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suf_M00002  Glycolysis, core module involving three-carbon compounds
suf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARLGA251_21980
  09102 Energy metabolism
   00680 Methane metabolism
    SARLGA251_21980
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SARLGA251_21980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:suf04131]
    SARLGA251_21980
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suf04147]
    SARLGA251_21980
Enzymes [BR:suf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SARLGA251_21980
Membrane trafficking [BR:suf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SARLGA251_21980
Exosome [BR:suf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SARLGA251_21980
  Exosomal proteins of melanoma cells
   SARLGA251_21980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCC88962
LinkDB All DBs
Position
complement(2422935..2423621)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcctacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaaccgatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system