KEGG   Staphylococcus aureus subsp. aureus LGA251 (MRSA): SARLGA251_22290Help
Entry
SARLGA251_22290   CDS       T02085                                 

Gene name
opuCA
Definition
(GenBank) putative glycine betaine/carnitine/choline transport ATP-binding protein
  KO
K05847  osmoprotectant transport system ATP-binding protein [EC:7.6.2.9]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251 (MRSA)
Pathway
suf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:suf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SARLGA251_22290 (opuCA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:suf02000]
    SARLGA251_22290 (opuCA)
Enzymes [BR:suf01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     SARLGA251_22290 (opuCA)
Transporters [BR:suf02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    SARLGA251_22290 (opuCA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CBS AAA_21 AAA_15 Zeta_toxin AAA_16 AAA_22 AAA_30 AAA AAA_29 RsgA_GTPase AAA_18 AAA_28
Motif
Other DBs
NCBI-ProteinID: CCC88993
LinkDB All DBs
Structure
PDB: 

Position
complement(2461299..2462525)
Genome map
AA seq 408 aa AA seqDB search
MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQIE
IDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKELIK
LVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKT
LQRKLGKTFIFVTHDMDEAIKLADKICIMSEGNVVQFDTPDNILRHPANDFVRDFIGQNR
LIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIEDI
NQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDKQRLVGLITRANV
VDIVYDTIWGDSEDAVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtattaagcatttaacgaaaatttattctggtaataaaaaggcagtagatgac
atctctttagatattcaatctggggaatttatcgcatttattggaaccagtggaagtggc
aaaacgactgctttaagaatgataaaccgtatgattgaagcgacagaaggacaaattgaa
attgatggtaaagacgttcggagtatgaatcctgtcgaattacgtagaaatattggctat
gttattcaacaaattggcttaatgcctcatatgacgattaaagagaatattgtgttggta
cccaaattgttgaaatggactaaagaagaaaaggataaacgtgcaaaggaattaattaaa
cttgtggatttaccggagtcatttttagagcgttatccagcagaactatcaggtgggcaa
caacaacgtatcggtgtcgtaagagcacttgcggccgaacaagatattattttaatggat
gaaccttttggtgcattggatcctattacgagagatacgttacaagatttagttaaaacg
ttacaacgaaaattaggcaagacgtttatctttgtaacacatgatatggatgaagcgatt
aaattagcagacaaaatttgtattatgtcagaagggaatgtggtgcaatttgatacacca
gacaatattttaagacatcccgcaaatgattttgtacgtgattttataggacaaaataga
ctgattcaagaccgtcccaatgacaagactgtagaaggtgtaatgattaaaccaatcacg
atacaagcagaagcaacactgaatgacgccgttcatattatgagacaaaaacgtgttgat
actatttttgtagtagatagtaataaccatttactaggtttcttagacattgaagatata
aatcagggtatacgtggacacaaaagtttacgagataccatgcaacaacatatttatacc
gttcaaattgattctaagttacaagattctgtacgtacgattttaaaaagaaacgttagg
aatgtacctgtcgtagatgataagcaacgtttagtaggactgattacgcgtgccaatgtt
gttgatattgtatatgacacgatttggggcgatagtgaggatgcagtgcaaacggaacat
gtgggggaagacactgcgtcctcaaaagtgcatgagcaacacactactaatgtcaaagta
cgtgacataggagatgataaatcatga

DBGET integrated database retrieval system