Sphingobium fuliginis ATCC 27551: FIL70_23485 Help Entry FIL70_23485       CDS       T06343                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sufl  Sphingobium fuliginis ATCC 27551 Pathway sufl01100   Metabolic pathways sufl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sufl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIL70_23485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIL70_23485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDC40066 UniProt:  A0A5B8CN59 LinkDB All DBs Position cSF2:complement(1154459..1154689) Genome browser AA seq 76 aa AA seqDB search MAVNMDDLLNLVGDIIEVDPSRIDLRLDRDDVPGWDSLAHLRIITAFEAQYGVRLSMDQI AEIRTVEQLSRTLGEA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctgtgaacatggacgacctgctgaaccttgtcggcgacatcatcgaagtcgatccg tcccggatcgacctgcgcctcgaccgggacgacgtgcccggctgggattcgctggcccat ctgcggatcatcaccgcgttcgaggcgcaatatggcgtgcgcctcagcatggaccagatc gccgagatccgcacggtggaacaattgtcgcggacattgggcgaggcgtga

DBGET integrated database retrieval system