KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG2161Help
Entry
SAPIG2161         CDS       T02071                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00240  Pyrimidine metabolism
sug01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sug00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAPIG2161 (tdk)
Enzymes [BR:sug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SAPIG2161 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_19
Motif
Other DBs
NCBI-ProteinID: CAQ50547
LinkDB All DBs
Structure
PDB: 

Position
complement(2237673..2238272)
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttaccattccggttggatagaatgtattacaggaagtatgtttagcggt
aaatccgaagaacttataagacgtttaagaaggggtatatacgctaaacaaaaagtcgtt
gtatttaaaccggcgattgatgatcgatatcataaagaaaaagtggtctctcataatggt
aatgccattgaagcgattaatatttctaaagcaagtgaaattatgacgcacgacttaact
aatgttgatgttataggaatagacgaagtgcaattttttgacgatgaaattgtaagtata
gtagaaaaactatcagcagatggacaccgtgttattgttgctggattagatatggatttt
aggggcgaaccgttcgaaccaatgcctaaattgatggctgtcagtgaacaagtaacgaaa
cttcaagcagtttgtgctgtttgtggttcttcatctagtagaacgcaacgattaataaat
ggtaaaccagctaaaatcgatgatccgattatcttagtaggtgccaatgaaagttatgag
ccacgttgtcgcgcgcaccatatcgtagcacctagtgataataataaggaggaattataa

DBGET integrated database retrieval system