KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG2164Help
Entry
SAPIG2164         CDS       T02071                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase [NADP+] (ssdh)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00010  Glycolysis / Gluconeogenesis
sug00053  Ascorbate and aldarate metabolism
sug00071  Fatty acid degradation
sug00280  Valine, leucine and isoleucine degradation
sug00310  Lysine degradation
sug00330  Arginine and proline metabolism
sug00340  Histidine metabolism
sug00380  Tryptophan metabolism
sug00410  beta-Alanine metabolism
sug00561  Glycerolipid metabolism
sug00620  Pyruvate metabolism
sug00625  Chloroalkane and chloroalkene degradation
sug01100  Metabolic pathways
sug01110  Biosynthesis of secondary metabolites
sug01120  Microbial metabolism in diverse environments
sug01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAPIG2164
   00053 Ascorbate and aldarate metabolism
    SAPIG2164
   00620 Pyruvate metabolism
    SAPIG2164
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAPIG2164
   00561 Glycerolipid metabolism
    SAPIG2164
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAPIG2164
   00310 Lysine degradation
    SAPIG2164
   00330 Arginine and proline metabolism
    SAPIG2164
   00340 Histidine metabolism
    SAPIG2164
   00380 Tryptophan metabolism
    SAPIG2164
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAPIG2164
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAPIG2164
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAPIG2164
Enzymes [BR:sug01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAPIG2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4262
Motif
Other DBs
NCBI-ProteinID: CAQ50550
LinkDB All DBs
Structure
PDB: 

Position
complement(2240554..2241981)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEVAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatatattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacaatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcattattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggcgttggaaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgttctagatgacgtagatatt
aaagaagtggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcgggaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagag
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcaattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system