KEGG   Staphylococcus argenteus: SAMSHR1132_09940Help
Entry
SAMSHR1132_09940  CDS       T01767                                 

Definition
(GenBank) putative succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
suh  Staphylococcus argenteus
Pathway
suh00020  Citrate cycle (TCA cycle)
suh00190  Oxidative phosphorylation
suh00650  Butanoate metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
Module
suh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAMSHR1132_09940
   00650 Butanoate metabolism
    SAMSHR1132_09940
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAMSHR1132_09940
Enzymes [BR:suh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAMSHR1132_09940
    1.3.5.4  fumarate reductase (quinol)
     SAMSHR1132_09940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C Slx4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCE58847
UniProt: A0A380C2D6
LinkDB All DBs
Position
1106711..1108477
Genome map
AA seq 588 aa AA seqDB search
MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDTARGIVAQNMT
TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
DESIFEERKAEEQARFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
ELMKRYENIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacatcttattgttgtcggaggtggcctagcaggcttaatgtcaacaatt
aaagcggcagaaaaaggtgcacatgtagacttgttctcagttgtgccggtaaaacgttcg
cactctgtttgtgcccaaggtggcattaatggtgcggtcaatactaaaggggaaggcgat
tctccttggattcactttgatgatacagtttatggtggagacttccttgcaaatcaacca
cctgttaaagcgatgacagaggcagcacctaagattattcatctattagaccgtatgggc
gttatgttcaatagaacaaatgaaggtctcttagattttagacgtttcggtggaacatta
caccacagaacagcatatgcaggggcaacaactggacaacaattattatatgcattagat
gaacaagtacgtgcatatgaagtagatggactagttacaaagtatgaaggttgggaattt
cttggcatagttaaaggtgatgacgatactgcaagaggtattgttgcacaaaatatgaca
accgctgaaatcgaaacatttggttcagacgctgttattatggcaactggtggtccaggt
atcatctttggtaaaacgaccaattcaatgattaatactggttcagcagcttcaatcgtg
tatcaacaaggtgcgatttatgctaatggtgagttcattcaaattcacccaactgcaatt
cctggtgatgataaactacgactcatgagtgaatcagcacgtggtgaaggtggacgtatt
tggacatataaagatggtaaaccttggtacttcttagaagaaaaatatcctgattatggt
aacttagtacctcgtgatatcgcgactcgtgaaatttttgacgtatgtattaaccaaaaa
ttaggtatcaatggtgaaaacatggtataccttgatttatcacataaagatccgcatgag
ttagatgttaaattaggtggtatcattgaaatttatgaaaaattcactggtgatgatcct
cgtaaagtaccaatgaaaattttcccagctgttcattattcaatgggtggactatatgta
gattatgatcaaatgacaaatattaaaggattgttcgcggctggtgagtgtgatttctct
caacatggtggtaaccgattaggtgccaactcattattatcagcaatttatggtggtaca
gttgcaggaccaaatgcgattgattatatttctaatattgatcgatcatatacagacatg
gatgagagtatttttgaagaacgtaaagctgaagaacaagcacgttttgataaattatta
gctatgcgtggtactgaaaatgcttataaacttcatcgagaacttggtgagattatgaca
gctaatgttaccgttgttcgtgaaaatgaaaaacttttagaaacagataaaaagattgtt
gaactaatgaaacgttatgaaaatattgatatggaagatactcaaacttggagtaaccaa
gcggtattctttactcgccaattatggaatatgttagtacttgctcgtgttatcacgatt
ggtgcatataatcgtaacgaatcaagaggtgcacattataaacctgaattcccagaacgt
aatgacgaagagtggttaaaaacaacaatggcctcattccaaggtgcatttgaaaagcca
caatttacttatgatgacgtcgatgtgagtttaattccaccacgtaaacgtgattatact
agtaagtctaaagggggtaaaaagtaa

DBGET integrated database retrieval system