KEGG   Staphylococcus argenteus: SAMSHR1132_09950Help
Entry
SAMSHR1132_09950  CDS       T01767                                 

Definition
(GenBank) putative succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
suh  Staphylococcus argenteus
Pathway
suh00020  Citrate cycle (TCA cycle)
suh00190  Oxidative phosphorylation
suh00650  Butanoate metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
Module
suh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAMSHR1132_09950
   00650 Butanoate metabolism
    SAMSHR1132_09950
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAMSHR1132_09950
Enzymes [BR:suh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAMSHR1132_09950
    1.3.5.4  fumarate reductase (quinol)
     SAMSHR1132_09950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CCE58848
UniProt: A0A380C1D7
LinkDB All DBs
Position
1108477..1109292
Genome map
AA seq 271 aa AA seqDB search
MTEQSVKDTPQHEVQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNINGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaatcagtaaaagacactccacaacatgaagtacaaagtaaaccaaaacaa
aaaactgtaaagttaattattaaacgtcaagatacaagtgattctaagccatacgaagaa
acatttgaaattccatatcgggaaaatttaaatgtaattgcgtgtttaatggaaattaga
cgaaacccagttaatattaatggtgaaaaaacaacaccagtcgtatgggacatgaactgt
cttgaagaagtttgtggtgcttgttcaatggttattaatggtcgtgctagacaatcatgt
tcagcgattgttgatcaattagaacaacctattcgcttagaaccaatgaacacattccca
gttattcgagatttacaagttgatcgttcaagaatgtttgataacttaaaacgtatgaaa
gcttggattccaattgatggcacttatgatttaggtcctgggccacgtatgcctgagaaa
aaacgtcaaacggcatatgagttgtctaaatgtatgacttgtggtgtatgtttagaagta
tgtcctaacgttactgaaaataataaattcgttggtgcgcaagcaatttcacaagtacgt
ttgtttaacttacacccaactggatcaatgactaaagatgaacgtttaaatgcattgatg
ggtacgggcggattacaacaatgtggtaattcgcaaaactgtgttaatgcttgccctaaa
ggtattcctttaacaacatcaattgcagcgatgaacagagaaacaactttccatatgttt
aaatcattctttggttctgaccatgaagtagaataa

DBGET integrated database retrieval system