KEGG   Staphylococcus argenteus: SAMSHR1132_15490Help
Entry
SAMSHR1132_15490  CDS       T01767                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00030  Pentose phosphate pathway
suh00051  Fructose and mannose metabolism
suh00052  Galactose metabolism
suh00680  Methane metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
suh01230  Biosynthesis of amino acids
suh03018  RNA degradation
Module
suh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suh_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_15490
   00030 Pentose phosphate pathway
    SAMSHR1132_15490
   00051 Fructose and mannose metabolism
    SAMSHR1132_15490
   00052 Galactose metabolism
    SAMSHR1132_15490
  09102 Energy metabolism
   00680 Methane metabolism
    SAMSHR1132_15490
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAMSHR1132_15490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:suh01009]
    SAMSHR1132_15490
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:suh03019]
    SAMSHR1132_15490
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAMSHR1132_15490
Protein phosphatases and associated proteins [BR:suh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAMSHR1132_15490
Messenger RNA biogenesis [BR:suh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAMSHR1132_15490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CCE59390
LinkDB All DBs
Position
complement(1706240..1707208)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQECQKELSEYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGFAVDLLMEGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaacaagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaacgaaattgaagtttatggtgtgtatcatggt
tatcaaggattgttaaatgatgatatccataagcttgaattaggttcagttggggatacg
attcaacgtggaggtacattcttgtattcagcaaggtgtccagagtttaaagaacaagaa
gtacgtaaagttgctattgaaaacttacgtaaaagaggcattgaaggacttgtagttatt
ggtggagacggtagttatcgaggagcgcaacgcattagtgaagaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
ttcgacacagcattaaacacaattattggtttagtagataaaattagagacactgcatca
agtcatgctcgaacgtttatcattgaagctatgggacgtgattgtggagacttagcattg
tgggctggattatcagtaggtgctgaaacaattgtagtaccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgcggtaaaaaacactcaatcgtt
cttgtagctgaaggatgtatgacagcgcaagagtgccaaaaagaattatcagaatacatt
aatgtcgataatagagtttctgttttaggtcacgttcaacgtggtggtagtccgacaggt
gcggatagagtattagcatcacgtttaggtggttttgctgtagacttattaatggaaggt
gaaacagctaaaggtgtcggtattaaaaataataaaatagtagcgacatcatttgatgaa
attttcgatggtaaagaccataaatttgattatagcctatacgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system