KEGG   Staphylococcus argenteus: SAMSHR1132_19450Help
Entry
SAMSHR1132_19450  CDS       T01767                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00053  Ascorbate and aldarate metabolism
suh00071  Fatty acid degradation
suh00280  Valine, leucine and isoleucine degradation
suh00310  Lysine degradation
suh00330  Arginine and proline metabolism
suh00340  Histidine metabolism
suh00380  Tryptophan metabolism
suh00410  beta-Alanine metabolism
suh00561  Glycerolipid metabolism
suh00620  Pyruvate metabolism
suh00625  Chloroalkane and chloroalkene degradation
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_19450
   00053 Ascorbate and aldarate metabolism
    SAMSHR1132_19450
   00620 Pyruvate metabolism
    SAMSHR1132_19450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAMSHR1132_19450
   00561 Glycerolipid metabolism
    SAMSHR1132_19450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMSHR1132_19450
   00310 Lysine degradation
    SAMSHR1132_19450
   00330 Arginine and proline metabolism
    SAMSHR1132_19450
   00340 Histidine metabolism
    SAMSHR1132_19450
   00380 Tryptophan metabolism
    SAMSHR1132_19450
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAMSHR1132_19450
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAMSHR1132_19450
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAMSHR1132_19450
Enzymes [BR:suh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAMSHR1132_19450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra DUF4262 Sec1
Motif
Other DBs
NCBI-ProteinID: CCE59778
UniProt: A0A380CLG7
LinkDB All DBs
Position
complement(2117789..2119216)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVNSNSNETIEVINPATEEVIGKVAKGNKEDVDRAVEAADSVYLEFRH
MPVKERQELLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALNT
FEFEERRGDDLVVKEGIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAATDFK
KVSLELGGKSPYIVLEDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNQIKDAFLAELK
EQFSQVRVGNPREEGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPDGLEKGYF
ARPTIFINVDNHMTIAQEEIFGPVMSVITYNDLDEAIEIANDTKYGLAGYVIGNDKETLR
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactatacaaagcaatatattaatggtgaatgggttaacagtaatagtaatgaa
acgatagaagttataaatccagcaactgaagaagtaattggtaaagttgcaaaaggaaat
aaagaagatgtagatagagcagttgaggcggctgacagtgtttatttagaattccgtcat
atgcctgtaaaagaaagacaagaactgctagataaaattgtaaaagaatatgaaaataga
aaagatgacattgtacaagcaattacagatgaactaggtgcaccactatcattatctgaa
cgtgttcattatcaaatggggttaaatcattttgttgcagcaagagatgctctgaatact
tttgaatttgaagaacgtcgtggagatgatttagttgttaaagaaggtattggtgtatca
ggtttaattacaccatggaatttcccgacgaatcaaacgtcattaaagttagcagcagca
tttgcagcgggtagtccagtggtacttaaaccttctgaagaaacaccatttgcagcagtt
attttagcggaaatatttgataaggttggtgttcctaaaggggtatttaaccttgtgaat
ggtgatggtgctggtgtaggtaatccattgtctgaacacccgaaagttcgtatgatgtca
tttactggttctggtccaactggatctaaaattatggaaaaggcagctactgactttaaa
aaagtatcacttgaacttggtggtaagtcaccatacatcgttttagaagatgtagatatt
aaagaagctgctaaagcaacaacaggaaaagtggttaacaatactggacaagtttgtact
gctggtacgcgcgtgttagttccaaatcaaattaaagatgcatttttagctgagttaaaa
gaacagtttagtcaagtacgtgttggtaatccgagagaagaaggaacgcaagtcggtcct
ataattagtaaaaaacaatttgatcaagtacaaaattatataaataaaggcattgaagaa
ggtgcagaattattctacggtggcccaggtaagcctgatggccttgaaaaaggttacttt
gcacgtccaacaatttttatcaatgttgataatcatatgaccattgcacaagaagaaatt
tttggaccggtgatgtcagtcatcacatataatgacttagatgaagcaattgaaattgct
aacgatactaaatatggtttagcaggttatgtcattggtaatgataaagaaacattgcgt
aaagtagcgcgctctattgaagcgggtactgtagaaatcaatgaagcaggtagaaaacca
gatttaccatttggtggttataagcagtctggattaggtcgtgaatggggcgactacggt
attgaagaatttttagaagtgaaatctattgcaggttactttaaataa

DBGET integrated database retrieval system