KEGG   Streptococcus suis JS14 (serotype 14): SSUJS14_1475Help
Entry
SSUJS14_1475      CDS       T02024                                 

Definition
(GenBank) phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
sui  Streptococcus suis JS14 (serotype 14)
Pathway
sui00630  Glyoxylate and dicarboxylate metabolism
sui01100  Metabolic pathways
sui01110  Biosynthesis of secondary metabolites
sui01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SSUJS14_1475
Enzymes [BR:sui01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     SSUJS14_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ADV70535
LinkDB All DBs
Position
1481106..1481756
Genome map
AA seq 216 aa AA seqDB search
MYQTILFDLDGTLTDSGQGILNSVAYALEKMGIEEPDTANLNRFIGPPLYESFSRFYQLS
PEDTQSAVDAFRVYFKEKGMFENQLYPGIIPLLEELRTAGKTLVIATSKPEIFAKQILEH
FGISHYFDVIAGASLDSSRISKADVICYAINQLEAFPNHAVMIGDREHDIEGARMHQLPA
IGVLYGYGNKQEFEKAGATMIVETVQDLKRVLLTTE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaaactatattatttgacttagatggaacacttactgattctggacaaggaatc
ttaaactccgtcgcctacgcactagaaaaaatgggaatcgaagaaccagatacagccaat
ttaaaccgattcatcggtccgccactctatgaatctttttctcgattctaccaactcagc
cctgaagatacacaaagtgcagttgatgctttccgtgtctattttaaagaaaaaggaatg
tttgaaaatcaactctatcctggaatcatccctctgcttgaagaattgagaacggctgga
aaaacactagtaattgctacctcaaagccagaaatatttgccaaacagattctagaacat
tttggtatctcacactactttgatgtcattgccggtgctagtctggatagtagtcgcatc
agtaaggcggacgtcatctgctatgctataaatcaattagaagcatttccaaaccatgct
gtgatgattggagatagggaacatgacattgaaggagcacgcatgcaccaacttcccgcc
atcggtgttctttacggctatgggaacaaacaggaatttgaaaaggctggggccaccatg
atagtcgaaaccgtccaagatttgaaaagggttttactgacaacagaatag

DBGET integrated database retrieval system