KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_00524Help
Entry
SAA6159_00524     CDS       T01870                                 

Gene name
hxlA
Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00030  Pentose phosphate pathway
suj00680  Methane metabolism
suj01100  Metabolic pathways
suj01120  Microbial metabolism in diverse environments
suj01200  Carbon metabolism
suj01230  Biosynthesis of amino acids
Module
suj_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
suj_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:suj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAA6159_00524 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAA6159_00524 (hxlA)
Enzymes [BR:suj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     SAA6159_00524 (hxlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim TMP-TENI PRAI His_biosynth PcrB QRPTase_C ThiG
Motif
Other DBs
NCBI-ProteinID: ADL22476
LinkDB All DBs
Position
607217..607849
Genome map
AA seq 210 aa AA seqDB search
MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVKHMADNISNVKVLADM
KIMDAADYEVSQAIKFGADVITILGVAEDASIKAAIEEAHKNNKQLLVDMIAVQDLEKRA
KELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKNSKVAVAGGIKPDTIKTIVAEN
PDLVIVGGGIANADDPVEAAKQCRAAIEGK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggaattacaattagcaattgatttattaaacaaagaagacgcggctgagttagcaaat
aaagtaaaagattatgtagatatcgtagaaatcggtacgccaatcatttacaacgaaggt
ttaccagcagtaaaacatatggcagacaacattagtaatgtaaaagtattagcagacatg
aaaattatggatgcagctgattatgaagttagccaagcaattaaatttggcgcggatgta
attacaatactaggtgttgcagaagatgcatcaattaaagcagctattgaagaagctcat
aaaaataataaacaattactagttgatatgattgctgttcaagatttagaaaaacgtgca
aaagaactagatgaaatgggtgctgattatattgcagtacacactggttatgatttacaa
gcagaagggcaatcaccattagaaagtttaagaaccgttaaatctgttattaaaaattct
aaagttgcagtagcaggtggaattaaaccagatacaattaaaacgattgttgctgaaaat
ccagaccttgtaattgttggtggcggaattgcaaatgcagacgatccagttgaagcagca
aaacaatgtcgagcggctatagaaggtaaataa

DBGET integrated database retrieval system