KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_00881Help
Entry
SAA6159_00881     CDS       T01870                                 

Gene name
comK
Definition
(GenBank) competence transcription factor ComK
  KO
K02250  competence protein ComK
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:suj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAA6159_00881 (comK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:suj03000]
    SAA6159_00881 (comK)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:suj02044]
    SAA6159_00881 (comK)
Transcription factors [BR:suj03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SAA6159_00881 (comK)
Secretion system [BR:suj02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   SAA6159_00881 (comK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: ADL22828
LinkDB All DBs
Position
complement(981882..982451)
Genome map
AA seq 189 aa AA seqDB search
MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIENIKELKNRKCK
VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMVSKNPDQPIDYNKATLNVFEAL
TRYSLFEDK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtattctcaaaatatttatgtaatacgtaaaggagacatggttattcgaccagcattt
gatgatgatgatcaaagaaatggtagcgaaattatccggttcgataaaacgcgtatacaa
aatccattcaaagtccagaaaatcattgaacgttcttgcaaattttatggtaatacttac
ctaggcaaaaaagcagaaacaaaccgcatcactggcatttcaagtaaaccacctatttta
ctaacaccattatttccaacttattttttcccaacacattctgacagacaaaatgaaaat
atttggttaaatatgcattatatagaaaatattaaggaattaaaaaatcgtaaatgtaaa
gtaacttttattaataacgaatctattattcttcatgtttcataccacagtttatggcac
caatataacaattccattttttactactatatggtagataaacaatctcgcatggtttct
aaaaatcccgatcaacctatagattataataaagccacattaaacgtatttgaagcattg
acacgctattccctattcgaagataaataa

DBGET integrated database retrieval system