KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00007Help
Entry
SAA6008_00007     CDS       T01886                                 

Definition
(GenBank) carbohydrate kinase
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAA6008_00007
Enzymes [BR:suk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     SAA6008_00007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ADL64095
LinkDB All DBs
Position
complement(9237..10067)
Genome map
AA seq 276 aa AA seqDB search
MGGYITMETLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITV
ATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQN
IQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDR
LGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSA
TYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgggaggttatatcactatggaaacgttaaattctattaacattcctaagcgtaaagaa
gattcacataaaggtgattatggcaaaattttattaattggtggatctgctaacttaggt
ggtgccattatgttagcggctcgtgcatgtgtatttagcggtagtggtttaatcactgta
gctacacatccaacaaatcattcagcattacattctcgttgcccagaagcgatggttatt
gatattaatgatacgaaaatgttgacgaaaatgattgaaatgactgacagtatactaatt
ggtccaggtcttggcgttgatttcaaaggaaataatgccattacattcctactacaaaat
atacaaccgcatcaaaatttaatcgtagacggcgatgccatcacaatctttagtaaattg
aaaccacaattacctacatgtcgcgtgatttttactccgcatctcaaagaatgggaacga
ttaagtggtattcctattgaggaacagacatatgagcgtaatcgtgaagcagttgatcgt
ttaggcgcaactgttgtacttaaaaaacacggtactgaaattttctttaaagatgaagac
tttaaattgacaatcggtagcccagcaatggcgactggtggtatgggcgatacacttgct
ggtatgattacaagttttgttggtcaatttgataacttaaaagaagcggttatgagtgcc
acatatacacatagttttattggcgaaaatcttgcaaaagatatgtatgtggtgccacca
tcaagacttatcaatgaaataccttacgcaatgaaacaattagaaagttag

DBGET integrated database retrieval system