KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00221Help
Entry
SAA6008_00221     CDS       T01886                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00040  Pentose and glucuronate interconversions
suk00051  Fructose and mannose metabolism
suk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAA6008_00221
   00051 Fructose and mannose metabolism
    SAA6008_00221
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAA6008_00221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD NAD_binding_3 UDPG_MGDP_dh_N TrkA_N adh_short ADH_N_2 3HCDH_N 2-Hacid_dh_C adh_short_C2 CHASE4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADL64296
LinkDB All DBs
Position
262343..263398
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCESKDYNLCNHRKGIGTQVDGAFT
NYVIAREESLHRIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGSGPIGLLVAQ
VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDILRKKGFYSQIGIFKDAEITFDMEKVIQKEITVVGSRSQKPADWEPSLQ
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcaggaatttgtggc
acagatattcatacttatgaaggtcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacttctgaaacgacattctatgtttgtaatgagtgtgaatactgtgaatcaaaa
gactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggcgcatttact
aattatgtcattgcacgtgaagaaagtttgcatcgtattccagacgaagtgtcgtatcag
tctgcagctatgacagaaccattagcatgtgcacatcatggcgtttctaagattcaagtc
aattcaggcgatgtagcagttgtaatgggatctgggccaatcggattacttgtagcacaa
gtgttgaaaagtaaaggcgcaactgttgtggtaactggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggaattacagacggatacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattacatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccggcagattgggaaccttcattgcaa
cttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatctggcgaaggtattaaagcattacttaag
ccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system