KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01379Help
Entry
SAA6008_01379     CDS       T01886                                 

Gene name
kgd
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring) E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00020  Citrate cycle (TCA cycle)
suk00310  Lysine degradation
suk00380  Tryptophan metabolism
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
Module
suk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAA6008_01379 (kgd)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SAA6008_01379 (kgd)
   00380 Tryptophan metabolism
    SAA6008_01379 (kgd)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SAA6008_01379 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N T3SS_HrpK1 DUF1542 DUF1840
Motif
Other DBs
NCBI-ProteinID: ADL65420
LinkDB All DBs
Position
complement(1467317..1470115)
Genome map
AA seq 932 aa AA seqDB search
MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIKNDDSIVPALKST
SSQNSDGTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGISA
GIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYKVTLNNN
EKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGM
AHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIKTTD
SYGTMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAGAPTTDHHKAMPIIIHGDAAYP
GQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKGYDVPIFHV
NADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPYQNIRKHDS
VEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINKADKMDNPDMEKPADLALPLQ
ADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGLVDWAQAEQLAFA
TILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGEKYTPLHHVPDQKATFDIHNSPLSEA
AVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSKWGERSGLTLFLPHAY
EGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAASLDSEQMRPLVVMSPK
SLLRNKTVAKPIDEFTSGGFEPILTESYQADKVTKVILATGKMFIDLKEALAKNPDESVL
LVAIERLYPFPEEEIEALLAQLPNLEEVSWVQEEPKNQGAWLYVYPYVKVLVADKYDLSY
HGRIQRAAPAEGDGEIHKLVQNKIIENALKNN
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgaaagaaaagaagtttcagaggctcctgtaaacttcggtgcgaatttaggt
ctaatgttagatctatatgatgactttttacaagatccatcatctgtaccagaagattta
caagtcttattcagcacaattaagaatgatgactcaattgtaccagctttaaaaagtaca
agtagtcaaaatagcgacggcacaattaagcgtgtcatgcgtttaattgataatattcgc
caatacgggcatcttaaagccgatatttatcctgtaaatcctccaaaaaggaaacatgta
cctaaattagagattgaagactttgatttagatcaacagactttggaaggtatatcagca
ggaattgtttcagatcactttgccgacatttatgataatgcttatgaagcaattttaaga
atggaaaaacgttacaaaggaccaattgcatttgagtatacacatattaataacaatacc
gaacgtggttggttaaaaagaagaattgaaacgccatataaagtaacgttaaataataac
gaaaaaagggcactattcaaacaattagcgtatgttgaagggtttgaaaaatatcttcat
aaaaacttcgttggtgcaaagcgtttttcaattgaaggggtagacgcacttgtaccgatg
ttacaacgtactattacgattgctgcgaaagaaggtattaaaaatatacaaataggcatg
gctcaccgtggacgtttaaacgttttaacgcatgtcttagaaaaaccgtacgaaatgatg
atttcagaatttatgcatacagatccaatgaaattcttacctgaagatggtagcttgcag
ttaactgctggatggactggtgatgtgaaatatcaccttggtggcattaaaactactgat
tcatacggtacaatgcagcgtattgcactggctaacaatccaagtcacttggaaattgtt
gcacctgttgttgaggggcgtacgagagcagcacaagatgatacacaacgagctggggct
ccgacgactgatcatcataaagcaatgccaattattatacatggcgatgctgcttatcct
ggtcaaggaattaacttcgaaacaatgaacttaggaaacttgaaaggctattctacgggt
ggttcattgcatattattactaacaatagaattggatttactacagaaccaattgatgca
cgttcaacaacttattctacagatgtggccaaaggttatgatgtgccaatattccatgtc
aatgcagatgacgttgaagctactattgaagcaattgatattgcaatggaatttagaaaa
gagtttcataaagacgtcgttattgatttagtaggttatcgtcgtttcggacataacgaa
atggatgaaccatcaattactaatccagttccttatcagaatattcgcaaacatgactct
gttgaatatgtgtttggtaaaaagcttgttaatgaaggtgtcatttcagaagatgaaatg
cattcatttatagaacaagtccaaaaggaactaagacaagctcatgataaaattaataaa
gctgataaaatggataatccagatatggaaaagcctgcagatcttgcattaccgttacaa
gcagacgaacaatcatttacttttgatcacttgaaagaaataaatgatgcattgttaaca
tatccggatggctttaacattttgaaaaagttaaacaaagttcttgagaagcgtcatgag
ccgtttaataaagaagatggtttagttgattgggcacaagcagaacaacttgcatttgcg
acaattttacaagatggtacaccgattcgcttaactggtcaagatagtgaacgtggtaca
ttcagtcataggcatgccgtgttacatgatgagcaaacaggtgaaaaatatacaccttta
catcatgttcctgatcaaaaagcgacatttgatatacacaattctccgctttcagaagca
gcagtagttggttttgaatacggctataatgtggaaaacaaaaaaagcttcaatatttgg
gaagcacaatatggtgattttgcaaatatgtcacaaatgatttttgacaacttcttattc
agttctcgctcaaaatggggagaacgttcaggattaacattattcttacctcatgcatat
gagggtcaagggcctgaacattcatcagcaagattagagcgatttttacaattagctgct
gaaaataattgcacagttgtcaacttatctagttcaagtaattatttccacttattgcgt
gcacaagcggctagtttagattctgaacaaatgcgaccattggttgttatgtcaccaaaa
agcttactgagaaataaaacagttgcaaaaccaattgatgaatttacttctggtggattt
gagccaattttgacagaatcatatcaagcggataaggttacaaaagttattttggcaact
ggtaaaatgttcattgatttaaaagaagcattagctaaaaatccagacgaatcagtatta
ctcgttgcgattgaaagattgtatccattcccagaggaagagattgaagcattactagca
caattgccaaaccttgaagaagtgtcatgggtacaagaagaacctaaaaatcaaggtgca
tggttatatgtctatccatatgttaaagtgctagttgcagataaatatgatttaagttat
catggcagaattcaaagggctgctccagctgaaggcgatggagaaattcataaacttgtt
caaaataaaattatagaaaatgcattaaaaaataactag

DBGET integrated database retrieval system